Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TYRP1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit TYRP1 Polyclonal Antibody | anti-TYRP1 antibody

TYRP1 antibody - N-terminal region

Gene Names
TYRP1; TRP; CAS2; CATB; GP75; OCA3; TRP1; TYRP; b-PROTEIN
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
TYRP1; Polyclonal Antibody; TYRP1 antibody - N-terminal region; anti-TYRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
Sequence Length
537
Applicable Applications for anti-TYRP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TYRP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TYRP1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TYRP1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TYRP1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TYRP1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TYRP1 antibody
This is a rabbit polyclonal antibody against TYRP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
Product Categories/Family for anti-TYRP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
5,6-dihydroxyindole-2-carboxylic acid oxidase
NCBI Official Synonym Full Names
tyrosinase related protein 1
NCBI Official Symbol
TYRP1
NCBI Official Synonym Symbols
TRP; CAS2; CATB; GP75; OCA3; TRP1; TYRP; b-PROTEIN
NCBI Protein Information
5,6-dihydroxyindole-2-carboxylic acid oxidase
UniProt Protein Name
5,6-dihydroxyindole-2-carboxylic acid oxidase
UniProt Gene Name
TYRP1
UniProt Synonym Gene Names
CAS2; TYRP; TYRRP; DHICA oxidase; TRP; TRP-1; TRP1

NCBI Description

This gene encodes a melanosomal enzyme that belongs to the tyrosinase family and plays an important role in the melanin biosynthetic pathway. Defects in this gene are the cause of rufous oculocutaneous albinism and oculocutaneous albinism type III. [provided by RefSeq, Mar 2009]

Uniprot Description

TYRP1: Oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. May regulate or influence the type of melanin synthesized. Defects in TYRP1 are the cause of albinism oculocutaneous type 3 (OCA3); also known as Rufous oculocutaneous albinism. An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. Tyrosinase activity is normal and patients have only moderate reduction of pigment. The eyes present red reflex on transillumination of the iris, dilution of color of iris, nystagmus and strabismus. Darker-skinned individuals have bright copper-red coloration of the skin and hair. Belongs to the tyrosinase family.

Protein type: Amino Acid Metabolism - tyrosine; EC 1.14.18.-; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 9p23

Cellular Component: endosome membrane; melanosome; melanosome membrane

Molecular Function: protein binding; protein heterodimerization activity; protein homodimerization activity

Biological Process: positive regulation of melanin biosynthetic process

Disease: Albinism, Oculocutaneous, Type Iii; Skin/hair/eye Pigmentation, Variation In, 11

Research Articles on TYRP1

Similar Products

Product Notes

The TYRP1 tyrp1 (Catalog #AAA3207312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TYRP1 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TYRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TYRP1 tyrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKRTTHPLFV IATRRSEEIL GPDGNTPQFE NISIYNYFVW THYYSVKKTF. It is sometimes possible for the material contained within the vial of "TYRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.