Western Blot (WB)
(Host: RabbitTarget Name: TYMSSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse TYMS Polyclonal Antibody | anti-TYMS antibody
TYMS Antibody - C-terminal region
Gene Names
Tyms; Ts
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TYMS; Polyclonal Antibody; TYMS Antibody - C-terminal region; anti-TYMS antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKM
Sequence Length
307
Applicable Applications for anti-TYMS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TYMS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TYMSSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TYMSSample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TYMS antibody
This gene encodes an enzyme that catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate as a cofactor. This function maintains the thymidine-5-prime monophosphate concentration critical for DNA replication and repair. The encoded enzyme is a target for cancer chemotherapeutic agents. The majority of transcripts for this gene lack a 3' UTR. The stop codon in these transcripts is UAA, compared to the UAG found in the genome and longer transcripts, as the polyA site is located within the stop codon. A related pseudogene has been identified on chromosome 10.
Product Categories/Family for anti-TYMS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
thymidylate synthase
NCBI Official Synonym Full Names
thymidylate synthase
NCBI Official Symbol
Tyms
NCBI Official Synonym Symbols
Ts
NCBI Protein Information
thymidylate synthase
UniProt Protein Name
Thymidylate synthase
Protein Family
UniProt Gene Name
Tyms
UniProt Synonym Gene Names
TS; TSase
NCBI Description
This gene encodes an enzyme that catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate as a cofactor. This function maintains the thymidine-5-prime monophosphate concentration critical for DNA replication and repair. The encoded enzyme is a target for cancer chemotherapeutic agents. The majority of transcripts for this gene lack a 3' UTR (PMID: 3022294, 3444407). The stop codon in these transcripts is UAA, compared to the UAG found in the genome and longer transcripts, as the polyA site is located within the stop codon (PMID: 3444407, 2157203). A related pseudogene has been identified on chromosome 10. [provided by RefSeq, Mar 2010]
Uniprot Description
Contributes to the de novo mitochondrial thymidylate biosynthesis pathway.
Research Articles on TYMS
Similar Products
Product Notes
The TYMS tyms (Catalog #AAA3223675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TYMS Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TYMS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TYMS tyms for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NHIEPLKIQL QREPRPFPKL KILRKVETID DFKVEDFQIE GYNPHPTIKM. It is sometimes possible for the material contained within the vial of "TYMS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
