Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TYMS Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTYMS is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit TYMS Polyclonal Antibody | anti-TYMS antibody

TYMS antibody - C-terminal region

Gene Names
TYMS; TS; TMS; HST422
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TYMS; Polyclonal Antibody; TYMS antibody - C-terminal region; anti-TYMS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME
Sequence Length
313
Applicable Applications for anti-TYMS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TYMS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TYMS Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTYMS is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-TYMS Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTYMS is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-TYMS antibody
This is a rabbit polyclonal antibody against TYMS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-47 CR601528.1 1-47 48-1099 X02308.1 14-1065 1100-1603 BC083512.1 1067-1570

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
thymidylate synthase isoform 1
NCBI Official Synonym Full Names
thymidylate synthetase
NCBI Official Symbol
TYMS
NCBI Official Synonym Symbols
TS; TMS; HST422
NCBI Protein Information
thymidylate synthase
UniProt Protein Name
Thymidylate synthase
UniProt Gene Name
TYMS
UniProt Synonym Gene Names
TS; TS; TSase
UniProt Entry Name
TYSY_HUMAN

NCBI Description

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. [provided by RefSeq, Aug 2017]

Uniprot Description

TYMS: an enzyme in the thymidylate synthase family. Polymorphisms serve as prognostic markers for determining modality of treatment in certain cancers. Genotyping helps predict toxicity to 5-FU-based chemotherapy in patients with colorectal cancer and the response to platinum-based chemotherapy in advanced NSCLC. A common polymorphism is a determinant of red blood cell folate and homocysteine concentrations. Homodimer.

Protein type: Nucleotide Metabolism - pyrimidine; Cofactor and Vitamin Metabolism - one carbon pool by folate; DNA repair, damage; EC 2.1.1.45; Mitochondrial; Methyltransferase

Chromosomal Location of Human Ortholog: 18p11.32

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm; mitochondrial inner membrane; nucleolus; nucleus; cytosol

Molecular Function: mRNA binding; protein homodimerization activity; nucleotide binding; drug binding; cofactor binding; thymidylate synthase activity; folic acid binding

Biological Process: immortalization of host cell by virus; methylation; tetrahydrofolate metabolic process; circadian rhythm; uracil metabolic process; developmental growth; response to organophosphorus; response to toxin; response to glucocorticoid stimulus; dTTP biosynthetic process; response to vitamin A; pyrimidine base metabolic process; response to folic acid; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; aging; response to drug; organ regeneration; nucleobase, nucleoside and nucleotide metabolic process; dTMP biosynthetic process; deoxyribonucleoside monophosphate biosynthetic process; G1/S-specific transcription in mitotic cell cycle; response to ethanol; response to cytokine stimulus; cartilage development; pyrimidine nucleoside biosynthetic process; dUMP metabolic process; mitotic cell cycle; response to progesterone stimulus; G1/S transition of mitotic cell cycle

Research Articles on TYMS

Similar Products

Product Notes

The TYMS tyms (Catalog #AAA3209064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TYMS antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TYMS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TYMS tyms for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HIEPLKIQLQ REPRPFPKLR ILRKVEKIDD FKAEDFQIEG YNPHPTIKME. It is sometimes possible for the material contained within the vial of "TYMS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.