Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TXNDC5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TXNDC5 Polyclonal Antibody | anti-TXNDC5 antibody

TXNDC5 antibody - N-terminal region

Gene Names
TXNDC5; HCC2; ERP46; HCC-2; STRF8; PDIA15; UNQ364; ENDOPDI
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TXNDC5; Polyclonal Antibody; TXNDC5 antibody - N-terminal region; anti-TXNDC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF
Sequence Length
432
Applicable Applications for anti-TXNDC5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TXNDC5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TXNDC5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TXNDC5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateTXNDC5 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-TXNDC5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateTXNDC5 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-TXNDC5 antibody
This is a rabbit polyclonal antibody against TXNDC5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. This gene can be co-transcribed with the upstream gene MU.
Product Categories/Family for anti-TXNDC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
thioredoxin domain-containing protein 5 isoform 1
NCBI Official Synonym Full Names
thioredoxin domain containing 5
NCBI Official Symbol
TXNDC5
NCBI Official Synonym Symbols
HCC2; ERP46; HCC-2; STRF8; PDIA15; UNQ364; ENDOPDI
NCBI Protein Information
thioredoxin domain-containing protein 5
UniProt Protein Name
Thioredoxin domain-containing protein 5
UniProt Gene Name
TXNDC5
UniProt Synonym Gene Names
TLP46; ER protein 46; ERp46
UniProt Entry Name
TXND5_HUMAN

NCBI Description

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal endoplasmic reticulum (ER)-signal sequence, three catalytically active thioredoxin domains and a C-terminal ER-retention sequence. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring upstream BLOC1S5 gene. [provided by RefSeq, Dec 2016]

Uniprot Description

TXNDC5: Possesses thioredoxin activity. Has been shown to reduce insulin disulfide bonds. Also complements protein disulfide- isomerase deficiency in yeast. Belongs to the protein disulfide isomerase family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p24.3

Cellular Component: lysosomal lumen; endoplasmic reticulum; endoplasmic reticulum lumen

Molecular Function: protein binding; protein disulfide isomerase activity

Biological Process: protein folding; cell redox homeostasis; post-Golgi vesicle-mediated transport; apoptotic cell clearance; negative regulation of apoptosis

Research Articles on TXNDC5

Similar Products

Product Notes

The TXNDC5 txndc5 (Catalog #AAA3213948) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TXNDC5 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TXNDC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TXNDC5 txndc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARAQEAAAAA ADGPPAADGE DGQDPHSKHL YTADMFTHGI QSAAHFVMFF. It is sometimes possible for the material contained within the vial of "TXNDC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.