Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TXKSample Tissue: leiomyosarcoma lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TXK Polyclonal Antibody | anti-TXK antibody

TXK Antibody - N-terminal region

Gene Names
TXK; RLK; TKL; BTKL; PTK4; PSCTK5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TXK; Polyclonal Antibody; TXK Antibody - N-terminal region; anti-TXK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: MRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRKPLPPL
Sequence Length
527
Applicable Applications for anti-TXK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TXK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TXKSample Tissue: leiomyosarcoma lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TXKSample Tissue: leiomyosarcoma lysatesAntibody Dilution: 1ug/ml)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
tyrosine-protein kinase TXK
NCBI Official Synonym Full Names
TXK tyrosine kinase
NCBI Official Symbol
TXK
NCBI Official Synonym Symbols
RLK; TKL; BTKL; PTK4; PSCTK5
NCBI Protein Information
tyrosine-protein kinase TXK
UniProt Protein Name
Tyrosine-protein kinase TXK
Protein Family
UniProt Gene Name
TXK
UniProt Synonym Gene Names
PTK4; RLK
UniProt Entry Name
TXK_HUMAN

Uniprot Description

TXK: Non-receptor tyrosine kinase that plays a redundant role with ITK in regulation of the adaptive immune response. Regulates the development, function and differentiation of conventional T- cells and nonconventional NKT-cells. When antigen presenting cells (APC) activate T-cell receptor (TCR), a series of phosphorylation lead to the recruitment of TXK to the cell membrane, where it is phosphorylated at Tyr-420. Phosphorylation leads to TXK full activation. Contributes also to signaling from many receptors and participates in multiple downstream pathways, including regulation of the actin cytoskekleton. Like ITK, can phosphorylate PLCG1, leading to its localization in lipid rafts and activation, followed by subsequent cleavage of its substrates. In turn, the endoplasmic reticulum releases calcium in the cytoplasm and the nuclear activator of activated T-cells (NFAT) translocates into the nucleus to perform its transcriptional duty. With PARP1 and EEF1A1, TXK forms a complex that acts as a T-helper 1 (Th1) cell- specific transcription factor and binds the promoter of IFNG to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production. Phosphorylates both PARP1 and EEF1A1. Phosphorylates also key sites in LCP2 leading to the up-regulation of Th1 preferred cytokine IL-2. Phosphorylates 'Tyr- 201' of CTLA4 which leads to the association of PI-3 kinase with the CTLA4 receptor. Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (non-receptor); EC 2.7.10.2; Kinase, protein; TK group; Tec family

Chromosomal Location of Human Ortholog: 4p12

Cellular Component: extrinsic to internal side of plasma membrane; cytoplasm; nucleus

Molecular Function: protein binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: adaptive immune response; transcription, DNA-dependent; protein amino acid autophosphorylation; cytokine production; T cell receptor signaling pathway; protein amino acid phosphorylation; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; interleukin-4 production; B cell receptor signaling pathway; positive regulation of interferon-gamma production; phospholipase C activation; interferon-gamma production; positive regulation of transcription from RNA polymerase II promoter; NK T cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; T cell differentiation

Research Articles on TXK

Similar Products

Product Notes

The TXK txk (Catalog #AAA3220438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TXK Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TXK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TXK txk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRTQISLSTD EELPEKYTQR RRPWLSQLSN KKQSNTGRVQ PSKRKPLPPL. It is sometimes possible for the material contained within the vial of "TXK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.