Western Blot (WB)
(WB Suggested Anti-TULP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human Muscle)
Rabbit TULP3 Polyclonal Antibody | anti-TULP3 antibody
TULP3 antibody - middle region
Gene Names
TULP3; TUBL3
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TULP3; Polyclonal Antibody; TULP3 antibody - middle region; anti-TULP3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESY
Sequence Length
442
Applicable Applications for anti-TULP3 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 77%; Horse: 77%; Human: 100%; Mouse: 85%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TULP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TULP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-TULP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human Muscle)
Related Product Information for anti-TULP3 antibody
This is a rabbit polyclonal antibody against TULP3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TULP3 is a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.This gene encodes a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.
Target Description: TULP3 is a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.This gene encodes a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.
Product Categories/Family for anti-TULP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
tubby-related protein 3 isoform 1
NCBI Official Synonym Full Names
tubby like protein 3
NCBI Official Symbol
TULP3
NCBI Official Synonym Symbols
TUBL3
NCBI Protein Information
tubby-related protein 3
UniProt Protein Name
Tubby-related protein 3
Protein Family
UniProt Gene Name
TULP3
UniProt Synonym Gene Names
TUBL3
UniProt Entry Name
TULP3_HUMAN
NCBI Description
This gene encodes a member of the tubby gene family of bipartite transcription factors. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved N-terminal transcription activation region and a conserved C-terminal DNA and phosphatidylinositol-phosphate binding region. The encoded protein binds to phosphoinositides in the plasma membrane via its C-terminal region and probably functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, for instance, induced by G-protein-coupled-receptor signaling. It plays an important role in neuronal development and function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2009]
Research Articles on TULP3
Similar Products
Product Notes
The TULP3 tulp3 (Catalog #AAA3201545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TULP3 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TULP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TULP3 tulp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLFPTYYMYL EKEENQKIFL LAARKRKKSK TANYLISIDP VDLSREGESY. It is sometimes possible for the material contained within the vial of "TULP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
