Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TUBE1 expression in transfected 293T cell line by TUBE1 polyclonal antibody. Lane 1: TUBE1 transfected lysate (52.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Tubulin epsilon Chain Polyclonal Antibody | anti-TUBE antibody

Tubulin epsilon Chain (Epsilon-tubulin, TUBE, TUBE1, dJ142L7.2) (HRP)

Gene Names
TUBE1; TUBE; dJ142L7.2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tubulin epsilon Chain; Polyclonal Antibody; Tubulin epsilon Chain (Epsilon-tubulin; TUBE; TUBE1; dJ142L7.2) (HRP); anti-TUBE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TUBE1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-TUBE antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TUBE1, aa1-475 (NP_057346.1).
Immunogen Sequence
MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TUBE1 expression in transfected 293T cell line by TUBE1 polyclonal antibody. Lane 1: TUBE1 transfected lysate (52.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TUBE1 expression in transfected 293T cell line by TUBE1 polyclonal antibody. Lane 1: TUBE1 transfected lysate (52.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TUBE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,932 Da
NCBI Official Full Name
tubulin epsilon chain
NCBI Official Synonym Full Names
tubulin, epsilon 1
NCBI Official Symbol
TUBE1
NCBI Official Synonym Symbols
TUBE; dJ142L7.2
NCBI Protein Information
tubulin epsilon chain; epsilon-tubulin
UniProt Protein Name
Tubulin epsilon chain
Protein Family
UniProt Gene Name
TUBE1
UniProt Synonym Gene Names
TUBE
UniProt Entry Name
TBE_HUMAN

NCBI Description

This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization of the microtubules during centriole duplication. A pseudogene of this gene is found on chromosome 5.[provided by RefSeq, Jan 2009]

Uniprot Description

Subcellular location: Cytoplasm › cytoskeleton › microtubule organizing center › centrosome. Note: Associated with pericentriolar material.

Sequence similarities: Belongs to the tubulin family.

Research Articles on TUBE

Similar Products

Product Notes

The TUBE tube1 (Catalog #AAA6397560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tubulin epsilon Chain (Epsilon-tubulin, TUBE, TUBE1, dJ142L7.2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tubulin epsilon Chain can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TUBE tube1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tubulin epsilon Chain, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.