Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide
recombinant proteins, antibodies and ELISA kits to most target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '30506'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.72 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '30506' and pd.language_id = 1
Query
Database
1.18 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '30506'
Query
Database
5.57 ms
UPDATE `products_description` SET `products_viewed` = products_viewed + 1
WHERE `products_id` = 30506
Database (5 total Queries, 5 of them unique across 2 Connections)
Time
Query String
2.42 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '30506'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '30506' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '30506'
⇄⧉testing_protocols => string (1802) "FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 ant...
$value['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 antibody at 1/100 dilution (purple) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.||AAA30506_FCM9.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC8.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC7.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue using anti-hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC2.jpg!!WB (Western Blot)||Western blot analysis of hUPF1 on PC-3M cell lysate using anti-hUPF1 antibody at 1/1, 000 dilution.||AAA30506_WB.jpg
⇄⧉etc_term1 => string (96) "Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within h...
$value['etc_term1']
Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within human hUPF1 aa 1-200.
⇄⧉products_description => string (1222) "In eukaryotes, it is essential to have the ability to detect and degrade tra...
$value['products_description']
In eukaryotes, it is essential to have the ability to detect and degrade transcripts that lack full coding potential. Nonsense-mediated RNA decay (NMD) protects the organism by avoiding the translation of truncated peptides with dominant negative or deleterious gain-of-function potential. Rent1, a mammalian ortholog of Upflp, is essential for embryonic viability. Rent1 (also designated regulator of nonsense transcripts and HUpf1) contains an N-terminal zinc finger-like domain, NTPase domains and a region comprised of domains that define Rent1 as a superfamily group I helicase. Rent1 protein has nucleic-acid-dependent ATPase activity and 5' to 3' helicase activity. In addition, Rent1 is an RNA-binding protein whose activity is modulated by ATP and directly interacts with Rent2, which is a mammalian homolog of Upf2p. Two mammalian orthologs to Upf3p, Rent3a and Rent3b, are encoded by two separate genes. Rent3b (also known as Rent3X) is encoded by a X-linked gene and localizes primarily to the nucleus, while Rent 1 and Rent 2 localize primarily in the cytoplasm. Specific Rent3 protein interactions with Y14 and spliced mRNA suggest Rent3a and Rent3b serve as a link between splicing and NMD in the cytoplasm.
⇄products_references => string (3) "N/A"
$value['products_references']
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart D...
$value['products_related_diseases']
Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart Diseases||3!!Prostatic Diseases||2!!Prostatic Neoplasms||2!!Immune System Diseases||2!!Adenocarcinoma||2!!Heart Defects, Congenital||2!!Poisoning||1
⇄products_categories => string (16) "Total protein Ab"
$value['products_categories']
⇄products_search_terms => string (3) "N/A"
$value['products_search_terms']
⇄ncbi_full_name => string (35) "Regulator of nonsense transcripts 1"
⇄⧉testing_protocols => string (1802) "FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 ant...
$value->a['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 antibody at 1/100 dilution (purple) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.||AAA30506_FCM9.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC8.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC7.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue using anti-hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC2.jpg!!WB (Western Blot)||Western blot analysis of hUPF1 on PC-3M cell lysate using anti-hUPF1 antibody at 1/1, 000 dilution.||AAA30506_WB.jpg
⇄⧉etc_term1 => string (96) "Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within h...
$value->a['etc_term1']
Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within human hUPF1 aa 1-200.
⇄⧉products_description => string (1222) "In eukaryotes, it is essential to have the ability to detect and degrade tra...
$value->a['products_description']
In eukaryotes, it is essential to have the ability to detect and degrade transcripts that lack full coding potential. Nonsense-mediated RNA decay (NMD) protects the organism by avoiding the translation of truncated peptides with dominant negative or deleterious gain-of-function potential. Rent1, a mammalian ortholog of Upflp, is essential for embryonic viability. Rent1 (also designated regulator of nonsense transcripts and HUpf1) contains an N-terminal zinc finger-like domain, NTPase domains and a region comprised of domains that define Rent1 as a superfamily group I helicase. Rent1 protein has nucleic-acid-dependent ATPase activity and 5' to 3' helicase activity. In addition, Rent1 is an RNA-binding protein whose activity is modulated by ATP and directly interacts with Rent2, which is a mammalian homolog of Upf2p. Two mammalian orthologs to Upf3p, Rent3a and Rent3b, are encoded by two separate genes. Rent3b (also known as Rent3X) is encoded by a X-linked gene and localizes primarily to the nucleus, while Rent 1 and Rent 2 localize primarily in the cytoplasm. Specific Rent3 protein interactions with Y14 and spliced mRNA suggest Rent3a and Rent3b serve as a link between splicing and NMD in the cytoplasm.
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart D...
$value->a['products_related_diseases']
Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart Diseases||3!!Prostatic Diseases||2!!Prostatic Neoplasms||2!!Immune System Diseases||2!!Adenocarcinoma||2!!Heart Defects, Congenital||2!!Poisoning||1
⇄products_categories => string (16) "Total protein Ab"
$value->a['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->a['products_search_terms']
⇄ncbi_full_name => string (35) "Regulator of nonsense transcripts 1"
⇄⧉testing_protocols => string (1802) "FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 ant...
$value->d['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 antibody at 1/100 dilution (purple) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.||AAA30506_FCM9.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC8.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC7.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue using anti-hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC2.jpg!!WB (Western Blot)||Western blot analysis of hUPF1 on PC-3M cell lysate using anti-hUPF1 antibody at 1/1, 000 dilution.||AAA30506_WB.jpg
⇄⧉etc_term1 => string (96) "Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within h...
$value->d['etc_term1']
Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within human hUPF1 aa 1-200.
⇄⧉products_description => string (1222) "In eukaryotes, it is essential to have the ability to detect and degrade tra...
$value->d['products_description']
In eukaryotes, it is essential to have the ability to detect and degrade transcripts that lack full coding potential. Nonsense-mediated RNA decay (NMD) protects the organism by avoiding the translation of truncated peptides with dominant negative or deleterious gain-of-function potential. Rent1, a mammalian ortholog of Upflp, is essential for embryonic viability. Rent1 (also designated regulator of nonsense transcripts and HUpf1) contains an N-terminal zinc finger-like domain, NTPase domains and a region comprised of domains that define Rent1 as a superfamily group I helicase. Rent1 protein has nucleic-acid-dependent ATPase activity and 5' to 3' helicase activity. In addition, Rent1 is an RNA-binding protein whose activity is modulated by ATP and directly interacts with Rent2, which is a mammalian homolog of Upf2p. Two mammalian orthologs to Upf3p, Rent3a and Rent3b, are encoded by two separate genes. Rent3b (also known as Rent3X) is encoded by a X-linked gene and localizes primarily to the nucleus, while Rent 1 and Rent 2 localize primarily in the cytoplasm. Specific Rent3 protein interactions with Y14 and spliced mRNA suggest Rent3a and Rent3b serve as a link between splicing and NMD in the cytoplasm.
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart D...
$value->d['products_related_diseases']
Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart Diseases||3!!Prostatic Diseases||2!!Prostatic Neoplasms||2!!Immune System Diseases||2!!Adenocarcinoma||2!!Heart Defects, Congenital||2!!Poisoning||1
⇄products_categories => string (16) "Total protein Ab"
$value->d['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->d['products_search_terms']
⇄ncbi_full_name => string (35) "Regulator of nonsense transcripts 1"
⇄⧉testing_protocols => string (1802) "FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 ant...
$value[0]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of PC-3M cells with hUPF1 antibody at 1/100 dilution (purple) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.||AAA30506_FCM9.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC8.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC7.jpg!!ICC (Immunocytochemistry)||ICC staining hUPF1 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30506_ICC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue using anti-hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon tissue using anti- hUPF1 antibody. Counter stained with hematoxylin.||AAA30506_IHC2.jpg!!WB (Western Blot)||Western blot analysis of hUPF1 on PC-3M cell lysate using anti-hUPF1 antibody at 1/1, 000 dilution.||AAA30506_WB.jpg
⇄⧉etc_term1 => string (96) "Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within h...
$value[0]['_source']['etc_term1']
Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within human hUPF1 aa 1-200.
⇄⧉products_description => string (1222) "In eukaryotes, it is essential to have the ability to detect and degrade tra...
$value[0]['_source']['products_description']
In eukaryotes, it is essential to have the ability to detect and degrade transcripts that lack full coding potential. Nonsense-mediated RNA decay (NMD) protects the organism by avoiding the translation of truncated peptides with dominant negative or deleterious gain-of-function potential. Rent1, a mammalian ortholog of Upflp, is essential for embryonic viability. Rent1 (also designated regulator of nonsense transcripts and HUpf1) contains an N-terminal zinc finger-like domain, NTPase domains and a region comprised of domains that define Rent1 as a superfamily group I helicase. Rent1 protein has nucleic-acid-dependent ATPase activity and 5' to 3' helicase activity. In addition, Rent1 is an RNA-binding protein whose activity is modulated by ATP and directly interacts with Rent2, which is a mammalian homolog of Upf2p. Two mammalian orthologs to Upf3p, Rent3a and Rent3b, are encoded by two separate genes. Rent3b (also known as Rent3X) is encoded by a X-linked gene and localizes primarily to the nucleus, while Rent 1 and Rent 2 localize primarily in the cytoplasm. Specific Rent3 protein interactions with Y14 and spliced mRNA suggest Rent3a and Rent3b serve as a link between splicing and NMD in the cytoplasm.
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart D...
$value[0]['_source']['products_related_diseases']
Nervous System Diseases||10!!Cardiovascular Diseases||4!!Atrophy||3!!Heart Diseases||3!!Prostatic Diseases||2!!Prostatic Neoplasms||2!!Immune System Diseases||2!!Adenocarcinoma||2!!Heart Defects, Congenital||2!!Poisoning||1
⇄products_categories => string (16) "Total protein Ab"
$value[0]['_source']['products_categories']
⇄ncbi_full_name => string (35) "Regulator of nonsense transcripts 1"
⇄⧉specificity => string (176) "This assay has high sensitivity and excellent specificity for detection of M...
$value[1]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of MCP/CD46. No significant crossreactivity or interference between MCP/CD46 and analogues was observed.
⇄purity => string (3) "N/A"
$value[1]['_source']['purity']
⇄form => string (3) "N/A"
$value[1]['_source']['form']
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[1]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[1]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉ncbi_pathways => string (362) "Complement And Coagulation Cascades Pathway||198880!!Complement And Coagulat...
$value[1]['_source']['ncbi_pathways']
Complement And Coagulation Cascades Pathway||198880!!Complement And Coagulation Cascades Pathway||83073!!Complement And Coagulation Cascades Pathway||484!!Complement Cascade Pathway||1269241!!Immune System Pathway||1269170!!Innate Immune System Pathway||1269203!!Measles Pathway||213306!!Measles Pathway||213277!!Regulation Of Complement Cascade Pathway||1269250
⇄⧉search_terms => string (654) "aaa17484 human this assay has high sensitivity and excellent specificity for...
$value[1]['_source']['search_terms']
aaa17484 human this assay has high sensitivity and excellent specificity for detection of mbp no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17484_sc elisa kit membrane cofactor protein mcp cd46 ahus2 mic10 molecule complement regulatory tlxcomplement trophoblast leucocyte common antigen lymphocyte reactive tlx tra2.10 36,826 da leukocyte cd_antigen mcp_human 262938 aab24802.1 p15529 q15429 q53gv9 q5hy94 q5vws6 q5vws7 q5vws8 q5vws9 q5vwt0 a0t1t0 a0t1t1 a0t1t2 120920 samples serum plasma tissue homogenates other biological fluids type sandwich range 0.156 10ng ml
⇄⧉form => string (139) "Supplied as lyophilized form in 20mM Tris, 500mM NaCI, pH8.0, containing 1mM...
$value[2]['_source']['form']
Supplied as lyophilized form in 20mM Tris, 500mM NaCI, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, and preservative.
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (599) "Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliq...
$value[2]['_source']['storage_stability']
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.<br>Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (66) "SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)"
⇄⧉ncbi_pathways => string (358) "Complement And Coagulation Cascades Pathway||198461!!Complement And Coagulat...
$value[2]['_source']['ncbi_pathways']
Complement And Coagulation Cascades Pathway||198461!!Complement And Coagulation Cascades Pathway||83465!!Complement And Coagulation Cascades Pathway||484!!Complement Cascade Pathway||936714!!Immune System Pathway||936650!!Innate Immune System Pathway||936679!!Measles Pathway||213300!!Measles Pathway||213277!!Regulation Of Complement Cascade Pathway||936721
⇄⧉search_terms => string (787) "aaa20256 e coli > 90 supplied as lyophilized form in 20mm tris 500mm naci ph...
$value[2]['_source']['search_terms']
aaa20256 e coli > 90 supplied as lyophilized form in 20mm tris 500mm naci ph8.0 containing 1mm edta dtt 0.01 sarcosyl 5 trehalose and preservative sds page western blot wb elisa eia immunoprecipitation ip sequence information aaa20256_seq aaa20256_sds3 testing data aaa20256_td2 recombinant protein membrane cofactor mcp cd46 molecule complement regulatory antigen 54.4kda mcp_rat 9506883 np_062063.1 q9z0m4 nm_019190.1 organism rattus norvegicus rat expression system prokaryotic residues met136~val341 accession # with two n terminal tags his tag gst subcellular location cytoplasmic vesicle secretory acrosome inner single pass endotoxin level <1.0eu per 1ug determined by the lal method predicted isoelectric point 6.7 reconstitution reconstitute sterile ddh2o >90 sarcosyl5 point6.7
⇄products_name_syn => string (37) "Outer membrane protein 1B; Porin OmpC"
$value[3]['_source']['products_name_syn']
⇄products_gene_name => string (4) "ompC"
$value[3]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[3]['_source']['products_gene_name_syn']
⇄⧉products_description => string (86) "Forms pores that allow passive diffusion of small molecules across the outer...
$value[3]['_source']['products_description']
Forms pores that allow passive diffusion of small molecules across the outer membrane.
⇄⧉products_references => string (2770) "A comparative study on the genes for three porins of the Escherichia coli ou...
$value[3]['_source']['products_references']
A comparative study on the genes for three porins of the Escherichia coli outer membrane. DNA sequence of the osmoregulated ompC gene.Mizuno T., Chou M.-Y., Inouye M.J. Biol. Chem. 258:6932-6940(1983)
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Automated multiplex sequencing of the E Coli genome.Richterich P., Lakey N., Gryan G., Jaehn L., Mintz L., Robison K., Church G.M. DNA sequence of the promoter region of the ompC gene and the amino acid sequence of the signal peptide of pro-OmpC protein of Escherichia coli.Mizuno T., Chou M.-Y., Inouye M.FEBS Lett. 151:159-164(1983)
Construction of a series of ompF-ompC chimeric genes by in vivo homologous recombination in Escherichia coli and characterization of the translational products.Nogami T., Mizuno T., Mizushima S.J. Bacteriol. 164:797-801(1985)
Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997)
Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis.Molloy M.P., Herbert B.R., Walsh B.J., Tyler M.I., Traini M., Sanchez J.-C., Hochstrasser D.F., Williams K.L., Gooley A.A.Electrophoresis 19:837-844(1998)
Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997)
Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)
Crystal structure of the membrane protein Ompc complex with antibacterial lactoferrin.Baalaji S., Acharya R.K., Singh T.P., Krishnaswamy S.Submitted (SEP-2006)
to the PDB data bank
⇄products_related_diseases => string (3) "N/A"
$value[3]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[3]['_source']['products_categories']
⇄ncbi_full_name => string (30) "outer membrane porin protein C"
⇄ncbi_protein_info => string (30) "outer membrane porin protein C"
$value[3]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[3]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (6) "946716"
$value[3]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "54.3 kDa"
$value[3]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (151) "Two-component System Pathway||1114!!Two-component System Pathway||437!!Beta-...
$value[3]['_source']['ncbi_pathways']
Two-component System Pathway||1114!!Two-component System Pathway||437!!Beta-Lactam Resistance Pathway||1060015!!Beta-Lactam Resistance Pathway||1084230
⇄sp_protein_name => string (24) "Outer membrane protein C"
$value[3]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (37) "Outer membrane protein 1B; Porin OmpC"
⇄⧉search_terms => string (1242) "aaa18709 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[3]['_source']['search_terms']
aaa18709 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18709_sds aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqiqgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnfmqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgvggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
recombinant protein outer membrane c escherichia strain k12 1b porin ompc butr eck2207 jw2203 meoa par 54.3 kda ompc_ecoli 16130152 np_416719.1 nc_000913.3 p06996 production note special offer host expressed is manufactured from a stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 small10 large1
⇄⧉products_description => string (464) "Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphoc...
$value[4]['_source']['products_description']
Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. It is a short-lived protein probably degraded by the proteasome.
⇄ncbi_full_name => string (25) "Latent membrane protein 1"
$value[4]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[4]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[4]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[4]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[4]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[4]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[4]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "23.0 kDa"
$value[4]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[4]['_source']['ncbi_pathways']
⇄sp_protein_name => string (25) "Latent membrane protein 1"
$value[4]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (11) "Protein p63"
$value[4]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (4) "LMP1"
$value[4]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (5) "LMP-1"
$value[4]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (9) "LMP1_EBVR"
$value[4]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[4]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[4]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[4]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[4]['_source']['products_viewed']
⇄⧉search_terms => string (1055) "aaa18574 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[4]['_source']['search_terms']
aaa18574 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18574_sds yyhgqrhsdehhhddslphpqqatddssnqsdsnsnegrhlllvsgagdgpplcsqnlgapgggpnngpqdpdntddngpqdpdntddngphdplpqdpdntddngpqdpdntddngphdplphnpsdsagndggppqlteevenkggdqgpplmtdgggghshdsghdgidphlptlllgtsgsggddddphgpvqlsyyd recombinant protein latent membrane 1 lmp1 epstein barr virus partial p63 23.0 kda lmp lmp1_ebvr 126375 p13198.1 p13198 production note special offer host expressed is manufactured from a stock plasmid containing gene yeasthost stocked in different unit sizes ranging small 10 ug large mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 membrane1 small10
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[5]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse LAMP2. No significant cross-reactivity or interference between mouse LAMP2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[5]['_source']['purity']
⇄form => string (3) "N/A"
$value[5]['_source']['form']
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[5]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (39) "lysosomal-associated membrane protein 2"
Mouse Lysosome-associated membrane glycoprotein 2 (LAMP2) ELISA kit; CD107b; LAMPB; LGP110; lysosome-associated membrane protein 2; lysosomal-associated membrane protein 2
⇄products_gene_name => string (5) "LAMP2"
$value[5]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[5]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[5]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for LAMP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any LAMP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for LAMP2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of LAMP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄⧉products_related_diseases => string (221) "Nervous System Diseases||68!!Heart Diseases||52!!Cardiomyopathies||48!!Glyco...
$value[5]['_source']['products_related_diseases']
Nervous System Diseases||68!!Heart Diseases||52!!Cardiomyopathies||48!!Glycogen Storage Disease Type IIb||36!!Brain Diseases||27!!Neoplasms||18!!Vascular Diseases||15!!Heart Failure||9!!Inflammation||7!!Kidney Diseases||7
lysosome-associated membrane glycoprotein 2; lysosomal membrane glycoprotein 2; CD107 antigen-like family member B; lysosomal membrane glycoprotein type B
⇄⧉search_terms => string (754) "aaa18109 mouse this assay has high sensitivity and excellent specificity for...
$value[5]['_source']['search_terms']
aaa18109 mouse this assay has high sensitivity and excellent specificity for detection of lamp2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18109_td elisa kit lysosomal associated membrane protein 2 lysosome glycoprotein cd107b lampb lgp110 isoform 1 mac3 lgp b lamp ii 2a 2b 2c cd107 antigen like family member type 45,681 da cd_antigen lamp2_mouse 63054837 np_001017959.1 p17047 nm_001017959.2 q3txg5 q8bsg8 a2a430 samples serum plasma tissue homogenates cell lysates quantitative sandwich range 31.25 pg ml 2000 < 7.81 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in protein2 isoform1
⇄⧉products_description => string (270) "Porin. Induces apoptosis in human cells through caspases-dependent and AIF-d...
$value[6]['_source']['products_description']
Porin. Induces apoptosis in human cells through caspases-dependent and AIF-dependent pathways. Purified Omp38 enters the cells and localizes to the mitochondria, which leads to a release of proapoptotic molecules such as cytochrome c and AIF (apoptosis-inducing factor).
⇄⧉products_references => string (244) "New insights into Acinetobacter baumannii pathogenesis revealed by high-dens...
$value[6]['_source']['products_references']
New insights into Acinetobacter baumannii pathogenesis revealed by high-density pyrosequencing and transposon mutagenesis.Smith M.G., Gianoulis T.A., Pukatzki S., Mekalanos J.J., Ornston L.N., Gerstein M., Snyder M.Genes Dev. 21:601-614(2007)
⇄products_related_diseases => string (3) "N/A"
$value[6]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[6]['_source']['products_categories']
⇄ncbi_full_name => string (28) "Outer membrane protein Omp38"
$value[6]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[6]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[6]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[6]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[6]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[6]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[6]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "38.5 kDa"
$value[6]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[6]['_source']['ncbi_pathways']
⇄sp_protein_name => string (28) "Outer membrane protein Omp38"
$value[6]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[6]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (5) "omp38"
$value[6]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[6]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (11) "OMP38_ACIBT"
$value[6]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[6]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[6]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[6]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[6]['_source']['products_viewed']
⇄⧉search_terms => string (1182) "aaa18619 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[6]['_source']['search_terms']
aaa18619 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18619_sds anagvtvtplllgytfqdsqhnnggkdgnltngpelqddlfvgaalgieltpwlgfeaeynqvkgdvdgasagaeykqkqingnfyvtsdlitknydskikpyvllgaghykydfdgvnrgtrgtseegtlgnagvgafwrlndalslrtearatynadeefwnytalaglnvvlgghlkpaapvvevapveptpvtpqpqeltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklnerlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsrtvvvqpgqeaaapaaaq
recombinant protein outer membrane omp38 acinetobacter baumannii 38.5 kda omp38_acibt 148839593 a3m8k2.2 a3m8k2 production note special offer host expressed is manufactured from a stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 small10 large1
⇄host => string (48) "E Coli or Yeast or Baculovirus or Mammalian Cell"
$value[7]['_source']['host']
⇄reactivity => string (3) "N/A"
$value[7]['_source']['reactivity']
⇄specificity => string (3) "N/A"
$value[7]['_source']['specificity']
⇄purity => string (57) "Greater or equal to 85% purity as determined by SDS-PAGE."
$value[7]['_source']['purity']
⇄⧉form => string (80) "Lyophilized or liquid (Format to be determined during the manufacturing proc...
$value[7]['_source']['form']
Lyophilized or liquid (Format to be determined during the manufacturing process)
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (189) "Store at -20 degree C. For extended storage, store at -20 or -80 degree C. N...
$value[7]['_source']['storage_stability']
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes ? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
⇄⧉products_name_syn => string (89) "Recombinant Latent membrane protein 2 (LMP2); Latent membrane protein 2; Ter...
$value[7]['_source']['products_name_syn']
Recombinant Latent membrane protein 2 (LMP2); Latent membrane protein 2; Terminal protein
⇄products_gene_name => string (4) "LMP2"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (4) "LMP2"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (913) "Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing ...
$value[7]['_source']['products_description']
Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs.Isoform LMP2B may be a negative regulator of isoform LMP2A.
⇄⧉search_terms => string (1126) "aaa18676 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[7]['_source']['search_terms']
aaa18676 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18676_sds mgslemvpmgagppspggdpdgydggnnsqypsasgssgntptppndeeresneeppppyedpywgngdrhsdyqplgtqdqslylglqhdgndglppppysprddssqhiyeeagrgsmnpvclpvivapylfwlaaiaascftas
recombinant protein latent membrane 2 lmp2 epstein barr virus partial terminal k15 lmp 2a 17.6 kda lmp2_ebvb9 82503189 yp_401631.1 1405236a nc_007605.1 p13285 q777h4 q8azk9 biology species strain b95 8 hhv 4 human herpesvirus production note special offer host expressed is manufactured from a stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 membrane2 b958 hhv4 small10 large1
Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E., Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001)
The methyl viologen-resistance-encoding gene smvA of Salmonella typhimurium.Hongo E., Morimyo M., Mita K., Machida I., Hama-Inaba H., Tsuji H., Ichimura S., Noda Y.Gene 148:173-174(1994)
Singh S.P., Miller S., Williams Y.U., Rudd K.E., Nikaido H.Unpublished observations (FEB-1996)
⇄products_related_diseases => string (3) "N/A"
$value[8]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[8]['_source']['products_categories']
⇄ncbi_full_name => string (33) "outer membrane porin protein OmpD"
$value[8]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[8]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (4) "ompD"
$value[8]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[8]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (33) "outer membrane porin protein OmpD"
$value[8]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[8]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (7) "1253090"
$value[8]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "53.6 kDa"
$value[8]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[8]['_source']['ncbi_pathways']
⇄sp_protein_name => string (33) "Outer membrane porin protein OmpD"
⇄⧉search_terms => string (662) "aaa18683 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[8]['_source']['search_terms']
aaa18683 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18683_sds aevynkdgnkldlygkvhaqhyfsddngsdgdktyarlgfkgetqindqltgfgqweyefkgnrtesqgadkdktrlafaglkfadygsfdygrnygvaydigawtdvlpefggdtwtqtdvfmtgrttgvatyrntdffglveglnfaaqyqgkndrdgayesngdgfglsatyeyegfgvgaayaksdrtnnqvkaasnlnaagknaevwaaglkydanniylattysetlnmttfgedaagdafianktqnfeavaqyqfdfglrpsiaylkskgknlgtygdqdlveyidvgatyyfnknmstfvdykinllddsdftkaakvstdnivavglnyqf
recombinant protein outer membrane porin ompd salmonella typhimurium 53.6 kda nmpc ompd_salty 16764916 np_460531.1 p37592 nc_003197.1 to85
⇄host => string (48) "E Coli or Yeast or Baculovirus or Mammalian Cell"
$value[9]['_source']['host']
⇄reactivity => string (3) "N/A"
$value[9]['_source']['reactivity']
⇄specificity => string (3) "N/A"
$value[9]['_source']['specificity']
⇄purity => string (57) "Greater or equal to 85% purity as determined by SDS-PAGE."
$value[9]['_source']['purity']
⇄⧉form => string (80) "Lyophilized or liquid (Format to be determined during the manufacturing proc...
$value[9]['_source']['form']
Lyophilized or liquid (Format to be determined during the manufacturing process)
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (415) "The shelf life is related to many factors, storage state, buffer ingredients...
$value[9]['_source']['storage_stability']
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.<br>Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.<br>The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.<br>Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
⇄products_name => string (31) "Outer membrane protein C (ompC)"
$value[9]['_source']['products_name']
⇄products_name_oem => string (60) "Recombinant Escherichia coli Outer membrane protein C (ompC)"
$value[9]['_source']['products_name_oem']
⇄products_name_syn => string (35) "Outer membrane protein 1BPorin OmpC"
$value[9]['_source']['products_name_syn']
⇄products_gene_name => string (4) "ompC"
$value[9]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[9]['_source']['products_gene_name_syn']
⇄⧉products_description => string (86) "Forms pores that allow passive diffusion of small molecules across the outer...
$value[9]['_source']['products_description']
Forms pores that allow passive diffusion of small molecules across the outer membrane.
⇄⧉products_references => string (151) "Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G...
$value[9]['_source']['products_references']
Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942 (2006)
⇄products_related_diseases => string (3) "N/A"
$value[9]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[9]['_source']['products_categories']
⇄ncbi_full_name => string (30) "outer membrane porin protein C"
⇄ncbi_protein_info => string (30) "outer membrane porin protein C"
$value[9]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[9]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (6) "946716"
$value[9]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "38.3 kDa"
$value[9]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (151) "Two-component System Pathway||1114!!Two-component System Pathway||437!!Beta-...
$value[9]['_source']['ncbi_pathways']
Two-component System Pathway||1114!!Two-component System Pathway||437!!Beta-Lactam Resistance Pathway||1060015!!Beta-Lactam Resistance Pathway||1084230
⇄sp_protein_name => string (24) "Outer membrane protein C"
$value[9]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (37) "Outer membrane protein 1B; Porin OmpC"
⇄⧉search_terms => string (1274) "aaa27012 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[9]['_source']['search_terms']
aaa27012 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa27012_sds aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqiqgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnfmqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgvggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
recombinant protein outer membrane c ompc escherichia 1bporin porin butr eck2207 jw2203 meoa par 38.3 kda 1b 16130152 np_416719.1 nc_000913.3 p06996 organism strain k12 tag information no tagged production note special offer host expressed is manufactured from a stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 small10 large1
⇄products_name => string (31) "Outer membrane protein A (ompA)"
$value[10]['_source']['products_name']
⇄products_name_oem => string (77) "Recombinant Escherichia coli O157:H7 Outer membrane protein A (ompA), partial"
$value[10]['_source']['products_name_oem']
⇄products_name_syn => string (26) "Outer membrane protein II*"
$value[10]['_source']['products_name_syn']
⇄products_gene_name => string (4) "ompA"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (252) "Required for the action of colicins K and L and for the stabilization of mat...
$value[10]['_source']['products_description']
Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes
⇄ncbi_full_name => string (24) "outer membrane protein A"
$value[10]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[10]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "ECs1041"
$value[10]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[10]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (24) "outer membrane protein A"
$value[10]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[10]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (6) "917123"
$value[10]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "35.6 kDa"
$value[10]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[10]['_source']['ncbi_pathways']
⇄sp_protein_name => string (24) "Outer membrane protein A"
$value[10]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (26) "Outer membrane protein II*"
$value[10]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (4) "ompA"
$value[10]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[10]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "OMPA_ECO57"
$value[10]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[10]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[10]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[10]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[10]['_source']['products_viewed']
⇄⧉search_terms => string (1071) "aaa18575 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[10]['_source']['search_terms']
aaa18575 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18575_sds wtnnigdahtigtrpdngmlslgvsyrfgqgeaapvvapapapapevqtkhftlksdvlfnfnkatlkpegqaaldqlysqlsnldpkdgsvvvlgytdrigsdaynqglserraqsvvdyliskgipadkisargmgesnpvtgntcdnvkqraalidclapdrrveievkgikdvvtqpqa
recombinant protein outer membrane a ompa escherichia o157:h7 partial ii* ecs1041 35.6 kda ompa_eco57 15830295 np_309068.1 nc_002695.1 p0a911 p02934 species production note special offer host expressed is manufactured from stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 small10 large1
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse PROS1. No significant cross-reactivity or interference between mouse PROS1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[11]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[11]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_name_syn => string (181) "Mouse Vitamin K-dependent protein S (PROS1) ELISA kit; PROS; PS21; PS22; PS2...
$value[11]['_source']['products_name_syn']
Mouse Vitamin K-dependent protein S (PROS1) ELISA kit; PROS; PS21; PS22; PS23; PS24; PS25; PSA; protein S; alpha; protein Sa; vitamin K-dependent plasma protein S; protein S (alpha)
⇄products_gene_name => string (5) "PROS1"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (626) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[11]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with PROS1. Standards or samples are added to the appropriate microtiter plate wells with Horseradish Peroxidase (HRP) conjugated antibody preparation specific for PROS1. The competitive inhibition reaction is launched between with pre-coated PROS1 and PROS1 in samples. A substrate solution is added to the wells and the color develops in opposite to the amount of PROS1 in the samples. The color development is stopped and the intensity of the color is measured.
Thrombophilia||60!!Blood Coagulation Disorders||58!!Thrombosis||46!!Cardiovascular Diseases||35!!Vascular Diseases||35!!Venous Thrombosis||27!!Thromboembolism||8!!Venous Thromboembolism||7!!Nervous System Diseases||5!!Neoplasms||5
⇄products_categories => string (3) "N/A"
$value[11]['_source']['products_categories']
⇄ncbi_full_name => string (29) "vitamin K-dependent protein S"
$value[11]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (17) "protein S (alpha)"
$value[11]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (5) "Pros1"
$value[11]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (8) "AW214361"
$value[11]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (29) "vitamin K-dependent protein S"
$value[11]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[11]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (5) "19128"
$value[11]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "74,934 Da"
$value[11]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (518) "Cell Surface Interactions At The Vascular Wall Pathway||575507!!Common Pathw...
$value[11]['_source']['ncbi_pathways']
Cell Surface Interactions At The Vascular Wall Pathway||575507!!Common Pathway||575505!!Complement And Coagulation Cascades Pathway||198335!!Complement And Coagulation Cascades Pathway||83270!!Complement And Coagulation Cascades Pathway||484!!Formation Of Fibrin Clot (Clotting Cascade) Pathway||575502!!Gamma-carboxylation Of Protein Precursors Pathway||575197!!Gamma-carboxylation, Transport, And Amino-terminal Cleavage Of Proteins Pathway||575196!!Hemostasis Pathway||575479!!Metabolism Of Proteins Pathway||575185
⇄sp_protein_name => string (29) "Vitamin K-dependent protein S"
$value[11]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[11]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (5) "Pros1"
$value[11]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (4) "Pros"
$value[11]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "PROS_MOUSE"
$value[11]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[11]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[11]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[11]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[11]['_source']['products_viewed']
⇄⧉search_terms => string (627) "aaa18061 mouse this assay has high sensitivity and excellent specificity for...
$value[11]['_source']['search_terms']
aaa18061 mouse this assay has high sensitivity and excellent specificity for detection of pros1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18061_td elisa kit protein s alpha vitamin k dependent pros ps21 ps22 ps23 ps24 ps25 psa sa plasma aw214361 74,934 da pros_mouse 46309455 np_035303.1 q08761 nm_011173.2 p43483 samples serum tissue homogenates type quantitative competitive range 6.25 ng ml 400 < 1.56 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml400
⇄⧉products_description => string (712) "Recombinant M protein (SARS-CoV-2)purified from E Coli. <br><br>Introduction...
$value[12]['_source']['products_description']
Recombinant M protein (SARS-CoV-2)purified from E Coli. <br><br>Introduction: The novel corona virus (SARS-CoV-2), previously called 2019-nCoV, is a newly identified corona virus causing the ongoing outbreak of atypical pneumoniainWuhan China from late 2019. The genome of SARS-CoV-2has 89% nucleotide identity with bat SARS-like-CoVZXC21 and 82% with that of human SARS-CoV. The phylogenetic trees of their orf1a/b, Spike, Envelope, Membrane and Nucleocapsid protein also clustered closely with those of the bat, civet and human SARS corona viruses. However, the external subdomain of Spike's receptor binding domain (RCB)of SARS-CoV-2 shares only 40% amino acid identity with other SARS-related corona viruses.
⇄⧉search_terms => string (504) "aaa13707 e coli >=95 sds page western blot wb standard antibody elisa eia an...
$value[12]['_source']['search_terms']
aaa13707 e coli >=95 sds page western blot wb standard antibody elisa eia antigen etc purified recombinant m protein of sars cov 2 aaa13707_sds rlfartrsmwsfnpetnillnvplhgtiltrplleselvigavilrghlriaghhlgrcdikdlpkeitvatsrtlsyyklgasqrvagdsgfaaysryrignyklntdhssssdniallvq covid 19 membrane coronavirus 2019 novel virus hcov human sars2 severe acute respiratory syndrome envelope ncov proteome covid19 cov2 ~15kda qhd43419 viral proteins corona source expressed and from endotoxin <1 eu per 1ug the by lal test
⇄⧉products_description => string (1104) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[13]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to target antigen. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific for target antigen and then avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. Then a TMB substrate solution is added to each well. Only those wells that contain target antigen, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The concentration of target antigen in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[13]['_source']['products_references']
⇄⧉products_related_diseases => string (205) "Kidney Diseases||198!!Nervous System Diseases||175!!Inflammation||88!!Protei...
⇄⧉products_description => string (674) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[14]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Mouse MAC monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉search_terms => string (365) "aaa12476 mouse no cross reaction with other factors typical testing data sta...
$value[14]['_source']['search_terms']
aaa12476 mouse no cross reaction with other factors typical testing data standard curve for reference only aaa12476_sc elisa kit membrane attack complex mac 675237085 cdz11901.1 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06ng intra precision <= 8 inter 12 range20 <=8 inter12
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[15]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human SIRPA. No significant cross-reactivity or interference between human SIRPA and analogues was observed.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[15]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[15]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[15]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[15]['_source']['products_weight']
⇄products_status => boolean true
$value[15]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[15]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[15]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[15]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[15]['_source']['language_id']
⇄products_name => string (31) "signal-regulatory protein alpha"
Human Tyrosine-protein phosphatase non-receptor type substrate 1 (SIRPA) ELISA kit; BIT; CD172A; MFR; MYD-1; P84; PTPNS1; SHPS-1; SHPS1; SIRP; SIRP-ALPHA-1; SIRPalpha; SIRPalpha2; SHP substrate-1; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; macrophage fu; signal-regulatory protein alpha
⇄products_gene_name => string (5) "SIRPA"
$value[15]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[15]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[15]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for SIRPA has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any SIRPA present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for SIRPA is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of SIRPA bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (171) "Neoplasms||32!!Skin Diseases||13!!Nervous System Diseases||12!!Prostatic Neo...
tyrosine-protein phosphatase non-receptor type substrate 1; myd-1 antigen; inhibitory receptor SHPS-1; macrophage fusion receptor; CD172 antigen-like family member A; tyrosine phosphatase SHP substrate 1; brain-immunoglobulin-like molecule with tyrosine-based activation motifs
⇄ncbi_chrom_loc => string (3) "N/A"
$value[15]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (6) "140885"
$value[15]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "54,967 Da"
$value[15]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (321) "Cell Surface Interactions At The Vascular Wall Pathway||106062!!Cell-Cell Co...
$value[15]['_source']['ncbi_pathways']
Cell Surface Interactions At The Vascular Wall Pathway||106062!!Cell-Cell Communication Pathway||477132!!Hemostasis Pathway||106028!!IL-1 Signaling Pathway||198908!!Osteoclast Differentiation Pathway||193147!!Osteoclast Differentiation Pathway||193096!!Signal Regulatory Protein (SIRP) Family Interactions Pathway||187209
⇄sp_protein_name => string (58) "Tyrosine-protein phosphatase non-receptor type substrate 1"
⇄⧉search_terms => string (873) "aaa18326 human this assay has high sensitivity and excellent specificity for...
$value[15]['_source']['search_terms']
aaa18326 human this assay has high sensitivity and excellent specificity for detection of sirpa no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18326_td elisa kit signal regulatory protein alpha tyrosine phosphatase non receptor type substrate 1 bit cd172a mfr myd p84 ptpns1 shps shps1 sirp sirpalpha sirpalpha2 shp brain immunoglobulin like molecule with based activation motifs macrophage fu antigen inhibitory fusion cd172 family member a 54,967 da ig 2 3 cd_antigen myd1 shps1_human 91105764 np_001035111.1 p78324 nm_001040022.1 o00683 o43799 q8n517 q8tal8 q9h0z2 q9udx2 q9uij6 q9y4u9 a2a2e1 a8k411 b2r6c3 602461 samples serum plasma tissue homogenates cell lysates quantitative sandwich range 0.156 ng ml 10 typically less than 0.039 intra precision within an cv substrate1 ig2 ml10
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of A...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of Aoc3. No significant cross-reactivity or interference between Aoc3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[16]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[16]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (651) "aaa17671 mouse this assay has high sensitivity and excellent specificity for...
$value[16]['_source']['search_terms']
aaa17671 mouse this assay has high sensitivity and excellent specificity for detection of aoc3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17671_sc elisa kit membrane primary amine oxidase vap 1 hpao ssao copper hpaossao semicarbazide sensitive vap1 vascular adhesion protein isoform 2 containing 3 24,533 da aoc3_human 480306390 np_001264660.1 q16853 nm_001277731.1 q45f94 b2rci5 k7esb3 l0l8n9 603735 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 31.25 2000pg ml 18.75pg intra precision cv isoform2 containing3
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[17]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human MAC monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (411) "aaa13055 human no cross reaction with other factors typical testing data sta...
$value[17]['_source']['search_terms']
aaa13055 human no cross reaction with other factors typical testing data standard curve for reference only aaa13055_sc elisa kit membrane attack complex mac 675237085 cdz11901.1 samples serum plasma or cell culture supernatant and organizations in the natural recombinant ltb4 concentration assay type sandwich detection range 1000 pg ml 15.6 sensitivity 5 intra precision <= 8 inter 12 sensitivity5 <=8 inter12
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of F...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FAM3D. No significant cross-reactivity or interference between FAM3D and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[18]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma, Tissue homogenates, Cell lysates and other biological fluids!!Detection Range||0.78-50ng/mL!!Sensitivity||0.29ng/mL
⇄⧉etc_term2 => string (416) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level FAM3D were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level FAM3D were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄products_price => string (6) "0.0000"
$value[18]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[18]['_source']['products_weight']
⇄products_status => boolean true
$value[18]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[18]['_source']['products_tax_class_id']
⇄manufacturers_id => string (4) "2000"
$value[18]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[18]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[18]['_source']['language_id']
⇄products_name => string (42) "Fibroblast Activation Protein Alpha (FAPa)"
⇄⧉products_description => string (988) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[18]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of FAM3D in human tissue homogenates, cell lysates and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to FAM3D. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to FAM3D. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain FAM3D, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of FAM3D in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (827) "aaa20764 human this assay has high sensitivity and excellent specificity for...
$value[18]['_source']['search_terms']
aaa20764 human this assay has high sensitivity and excellent specificity for detection of fam3d no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20764_sc elisa kit fibroblast activation protein alpha fapa apce simp dppiv seprase 170 kda melanoma membrane bound gelatinase post proline cleaving enzyme serine integral protease surface expressed isoform cra_b fap prolyl endopeptidase 26,954 da sepr_human 119631759 eax11354.1 q12884 o00199 q53tp5 q86z29 q99998 q9uid4 600403 tumor immunity dermatology samples tissue homogenates cell lysates other biological fluids type quantitative sandwich range 0.156 10ng ml 0.057ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv seprase170 an3 tested20
⇄⧉specificity => string (397) "This assay has high sensitivity and excellent specificity for detection of H...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HSP-90alpha. No significant cross-reactivity or interference between HSP-90alpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between HSP-90alpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1480) "Principle of the Assay: HSP-90alpha ELISA kit applies the competitive enzyme...
$value[19]['_source']['products_description']
Principle of the Assay: HSP-90alpha ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-HSP-90alpha antibody and an HSP-90alpha-HRP conjugate. The assay sample and buffer are incubated together with HSP-90alpha-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the HSP-90alpha concentration since HSP-90alpha from samples and HSP-90alpha-HRP conjugate compete for the anti-HSP-90alpha antibody binding site. Since the number of sites is limited, as more sites are occupied by HSP-90alpha from the sample, fewer sites are left to bind HSP-90alpha-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HSP-90alpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This HSP-90alpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse HSP-90alpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[19]['_source']['products_references']
⇄⧉products_related_diseases => string (229) "Nervous System Diseases||7!!Carcinoma, Hepatocellular||3!!Cardiovascular Dis...
