Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TTC30B expression in transfected 293T cell line by TTC30B polyclonal antibody. Lane 1: FLJ30990 transfected lysate (73.15kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TTC30B Polyclonal Antibody | anti-Ttc30b antibody

TTC30B (Tetratricopeptide Repeat Protein 30B, TPR Repeat Protein 30B, FLJ30990)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TTC30B; Polyclonal Antibody; TTC30B (Tetratricopeptide Repeat Protein 30B; TPR Repeat Protein 30B; FLJ30990); Anti -TTC30B (Tetratricopeptide Repeat Protein 30B; anti-Ttc30b antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FLJ30990.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLHLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI
Applicable Applications for anti-Ttc30b antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FLJ30990, aa1-665 (AAH33795).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TTC30B expression in transfected 293T cell line by TTC30B polyclonal antibody. Lane 1: FLJ30990 transfected lysate (73.15kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TTC30B expression in transfected 293T cell line by TTC30B polyclonal antibody. Lane 1: FLJ30990 transfected lysate (73.15kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-Ttc30b antibody
Required for polyglutamylation of axonemal tubulin (By similarity). Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip (By similarity).
Product Categories/Family for anti-Ttc30b antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
76,077 Da
NCBI Official Full Name
Ttc30b protein
NCBI Official Synonym Full Names
tetratricopeptide repeat domain 30B
NCBI Official Symbol
Ttc30b
NCBI Protein Information
tetratricopeptide repeat protein 30B; TPR repeat protein 30B
UniProt Protein Name
Tetratricopeptide repeat protein 30B
UniProt Gene Name
Ttc30b
UniProt Synonym Gene Names
TPR repeat protein 30B
UniProt Entry Name
TT30B_RAT

Uniprot Description

Function: Required for polyglutamylation of axonemal tubulin

By similarity. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip

By similarity.

Subcellular location: Cell projection › cilium

By similarity.

Sequence similarities: Belongs to the TTC30/dfy-1/fleer family.Contains 8 TPR repeats.

Similar Products

Product Notes

The Ttc30b ttc30b (Catalog #AAA6013604) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TTC30B (Tetratricopeptide Repeat Protein 30B, TPR Repeat Protein 30B, FLJ30990) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TTC30B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Ttc30b ttc30b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGLSGAQIP DGEFTAVVYR LIRNARYAEA VQLLGGELQR SPRSRAGLSL LGYCYYRLQE FALAAECYEQ LGQLHPELEQ YRLYQAQALY KACLYAEATR VAFLLLDNPA YHSRVLHLQA AIKYSEGDLP GSRSLVEQLP SREGGEESGG ENETDGQINL GCLLYKEGQY EAACSKFFAA LQASGYQPDL SYNLALAYYS SRQYASALKH IAEIIERGIR QHPELGVGMT TEGIDVRSVG NTLVLHQTAL VEAFNLKAAI EYQLRNYEAA QEALTDMPPR AEEELDPVTL HNQALMNMDA RPTEGFEKLQ FLLQQNPFPP ETFGNLLLLY CKYEYFDLAA DVLAENAHLI YKFLTPYLYD FLDAVITCQT APEEAFIKLD GLAGMLTEVL RKLTIQVQEA RHNRDDEAIK KAVNEYDETM EKYIPVLMAQ AKIYWNLENY PMVEKIFRKS VEFCNDHDVW KLNVAHVLFM QENKYKEAIG FYEPIVKKHY DNILNVSAIV LANLCVSYIM TSQNEEAEEL MRKIEKEEEQ LSYDDPDKKM YHLCIVNLVI GTLYCAKGNY DFGISRVIKS LEPYNKKLGT DTWYYAKRCF LSLLENMSKH TIMLRDSVIQ ECVQFLEHCE LHGRNIPAVI EQPLEEERMH VGKNTVTYES RQLKALIYEI IGWNI. It is sometimes possible for the material contained within the vial of "TTC30B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.