Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Mouse retinaApplication: ImmunofluorescenceSpecies+tissue/cell type: Mouse retina tissuePrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexafluor 568Secondary antibody dilution: 1:200)

Rabbit RAB3IP Polyclonal Antibody | anti-RAB3IP antibody

RAB3IP antibody - N-terminal region

Gene Names
RAB3IP; RABIN3; RABIN8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RAB3IP; Polyclonal Antibody; RAB3IP antibody - N-terminal region; anti-RAB3IP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD
Sequence Length
476
Applicable Applications for anti-RAB3IP antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RAB3IP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Mouse retinaApplication: ImmunofluorescenceSpecies+tissue/cell type: Mouse retina tissuePrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexafluor 568Secondary antibody dilution: 1:200)

Immunohistochemistry (IHC) (Sample Type: Mouse retinaApplication: ImmunofluorescenceSpecies+tissue/cell type: Mouse retina tissuePrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexafluor 568Secondary antibody dilution: 1:200)

Western Blot (WB)

(WB Suggested Anti-RAB3IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-RAB3IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-RAB3IP antibody
This is a rabbit polyclonal antibody against RAB3IP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The specific function of this protein remains unknown.
Product Categories/Family for anti-RAB3IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
rab-3A-interacting protein isoform alpha 2
NCBI Official Synonym Full Names
RAB3A interacting protein
NCBI Official Symbol
RAB3IP
NCBI Official Synonym Symbols
RABIN3; RABIN8
NCBI Protein Information
rab-3A-interacting protein
UniProt Protein Name
Rab-3A-interacting protein
UniProt Gene Name
RAB3IP
UniProt Synonym Gene Names
RABIN8; Rab3A-interacting protein
UniProt Entry Name
RAB3I_HUMAN

Uniprot Description

RAB3IP: Guanine nucleotide exchange factor for RAB8A. Mediates the release of GDP from RAB8A but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Belongs to the SEC2 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Rab

Chromosomal Location of Human Ortholog: 12q15

Cellular Component: centrosome; cytoskeleton; lamellipodium; nucleus; cytosol

Molecular Function: protein binding; Rab guanyl-nucleotide exchange factor activity

Biological Process: Golgi to plasma membrane transport; protein localization in organelle; organelle organization and biogenesis; cilium biogenesis; protein targeting to membrane

Research Articles on RAB3IP

Similar Products

Product Notes

The RAB3IP rab3ip (Catalog #AAA3211249) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB3IP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3IP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RAB3IP rab3ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APCSTSGVTA GLTKLTTRKD NYNAEREFLQ GATITEACDG SDDIFGLSTD. It is sometimes possible for the material contained within the vial of "RAB3IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.