Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TSPAN3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human TSPAN3 Polyclonal Antibody | anti-TSPAN3 antibody
TSPAN3 Polyclonal Antibody
Gene Names
TSPAN3; TM4-A; TM4SF8; TSPAN-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TSPAN3; Polyclonal Antibody; TSPAN3 Polyclonal Antibody; TM4-A; TM4SF8; TSPAN-3; anti-TSPAN3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEIMM
Sequence Length
189
Applicable Applications for anti-TSPAN3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TSPAN3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Multi-pass membrane protein
Positive Samples
HT-29, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TSPAN3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TSPAN3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-TSPAN3 antibody
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Multiple alternative transcripts encoding different isoforms have been described.
Product Categories/Family for anti-TSPAN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 21kDa; 25kDa; 28kDa
Observed: 28kDa
Observed: 28kDa
NCBI Official Full Name
tetraspanin-3 isoform 3
NCBI Official Synonym Full Names
tetraspanin 3
NCBI Official Symbol
TSPAN3
NCBI Official Synonym Symbols
TM4-A; TM4SF8; TSPAN-3
NCBI Protein Information
tetraspanin-3
UniProt Protein Name
Tetraspanin-3
UniProt Gene Name
TSPAN3
UniProt Synonym Gene Names
TM4SF8; Tspan-3
NCBI Description
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Multiple alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Dec 2009]
Uniprot Description
Regulates the proliferation and migration of oligodendrocytes, a process essential for normal myelination and repair.
Research Articles on TSPAN3
Similar Products
Product Notes
The TSPAN3 tspan3 (Catalog #AAA9134826) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSPAN3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSPAN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TSPAN3 tspan3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YVYRAKVENE VDRSIQKVYK TYNGTNPDAA SRAIDYVQRQ LHCCGIHNYS DWENTDWFKE TKNQSVPLSC CRETASNCNG SLAHPSDLYA EGCEALVVKK LQEIMM. It is sometimes possible for the material contained within the vial of "TSPAN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
