Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.17kD).)

Mouse anti-Human MDH2 Monoclonal Antibody | anti-MDH2 antibody

MDH2 (Malate Dehydrogenase, Mitochondrial, MGC3559) (FITC)

Gene Names
MDH2; MDH; MOR1; M-MDH; EIEE51; MGC:3559
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MDH2; Monoclonal Antibody; MDH2 (Malate Dehydrogenase; Mitochondrial; MGC3559) (FITC); anti-MDH2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12
Specificity
Recognizes human MDH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MDH2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa134-246 from human MDH2 (NP_005909) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.17kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.17kD).)

Western Blot (WB)

(MDH2 monoclonal antibody. Western Blot analysis of MDH2 expression in IMR-32.)

Western Blot (WB) (MDH2 monoclonal antibody. Western Blot analysis of MDH2 expression in IMR-32.)

Testing Data

(Detection limit for recombinant GST tagged MDH2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MDH2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-MDH2 antibody
MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
Product Categories/Family for anti-MDH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.2 kDa (335aa), confirmed by MALDI-TOF
NCBI Official Full Name
malate dehydrogenase, mitochondrial isoform 1
NCBI Official Synonym Full Names
malate dehydrogenase 2
NCBI Official Symbol
MDH2
NCBI Official Synonym Symbols
MDH; MOR1; M-MDH; EIEE51; MGC:3559
NCBI Protein Information
malate dehydrogenase, mitochondrial
UniProt Protein Name
Malate dehydrogenase, mitochondrial
Protein Family
UniProt Gene Name
MDH2
UniProt Entry Name
MDHM_HUMAN

NCBI Description

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

MDH2: mitochondrial malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. May play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Protein type: Mitochondrial; Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 1.1.1.37; Carbohydrate Metabolism - citrate (TCA) cycle; Oxidoreductase

Chromosomal Location of Human Ortholog: 7cen-q22

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; plasma membrane; nucleus

Molecular Function: protein self-association; L-malate dehydrogenase activity; malate dehydrogenase (NADP+) activity

Biological Process: cellular metabolic process; malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; carbohydrate metabolic process; glucose metabolic process; cellular carbohydrate metabolic process; pathogenesis; internal protein amino acid acetylation; gluconeogenesis

Research Articles on MDH2

Similar Products

Product Notes

The MDH2 mdh2 (Catalog #AAA6148172) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MDH2 (Malate Dehydrogenase, Mitochondrial, MGC3559) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDH2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MDH2 mdh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.