Western Blot (WB)
(WB Suggested Anti-TSPAN17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Rabbit TSPAN17 Polyclonal Antibody | anti-TSPAN17 antibody
TSPAN17 antibody - N-terminal region
Gene Names
TSPAN17; FBX23; FBXO23; TM4SF17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSPAN17; Polyclonal Antibody; TSPAN17 antibody - N-terminal region; anti-TSPAN17 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI
Sequence Length
332
Applicable Applications for anti-TSPAN17 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TSPAN17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TSPAN17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TSPAN17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TSPAN17 antibody
This is a rabbit polyclonal antibody against TSPAN17. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function of TSPAN17 remains unknown.
Target Description: The function of TSPAN17 remains unknown.
Product Categories/Family for anti-TSPAN17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
tetraspanin-17 isoform a
NCBI Official Synonym Full Names
tetraspanin 17
NCBI Official Symbol
TSPAN17
NCBI Official Synonym Symbols
FBX23; FBXO23; TM4SF17
NCBI Protein Information
tetraspanin-17
UniProt Protein Name
Tetraspanin-17
UniProt Gene Name
TSPAN17
UniProt Synonym Gene Names
FBXO23; TM4SF17; Tspan-17
UniProt Entry Name
TSN17_HUMAN
NCBI Description
This gene encodes a member of the transmembrane 4 superfamily. It is characterized by four tetraspanin transmembrane segments. The function of this gene has not yet been determined. [provided by RefSeq, Mar 2014]
Uniprot Description
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the tetraspanin (TM4SF) family.
Sequence caution: The sequence AAF04524.1 differs from that shown. Reason: Frameshift at positions 66, 81 and 83.
Research Articles on TSPAN17
Similar Products
Product Notes
The TSPAN17 tspan17 (Catalog #AAA3206640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSPAN17 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TSPAN17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSPAN17 tspan17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVMSVLGFAG CIGALRENTF LLKFFSVFLG LIFFLELATG ILAFVFKDWI. It is sometimes possible for the material contained within the vial of "TSPAN17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
