Rabbit TRPV5 Polyclonal Antibody | anti-TRPV5 antibody

TRPV5 antibody - N-terminal region

Cat. Num. AAA3209464

• Gene Names: TRPV5; CAT2; ECAC1; OTRPC3
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: TRPV5; Polyclonal Antibody; TRPV5 antibody - N-terminal region; anti-TRPV5 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
• Sequence Length: 729

• Applicable Applications for anti-TRPV5 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 77%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 77%; Rat: 85%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPV5
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: HumanSample Type: hRetinal pigment epithelial cellsGreen: primaryRed: nuclearPrimary Dilution: 1:200Secondary Antibody: goat anti-rabbit-Alexa 488Secondary Dilution: 1:500Image Submitted by: Brian KennedyIndiana University Northwest See Customer Feedback tab for detailed information.)

Western Blot (WB)

(Sample Type: HumanSample Type: 1-4. hRetinal pigment epithelial cells, 4 individual donors (20ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-rabbit-APSecondary Dilution: 1:2000Image Submitted by: Brian KennedyIndiana University Northwest See Customer Feedback tab for detailed information.)

Western Blot (WB)

(WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateTRPV5 is supported by BioGPS gene expression data to be expressed in 721_B)

Related Product Information for anti-TRPV5 antibody

This is a rabbit polyclonal antibody against TRPV5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2486 AF304464.1 86-2571

Product Categories/Family for anti-TRPV5 antibody

Polyclonal; Ion Channel; Membrane Protein; Immunohistochemistry; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 730229359
• NCBI GeneID: 56302
• NCBI Accession #: NP_062815
• NCBI GenBank Nucleotide #: NM_019841
• UniProt Accession #: Q9NQA5
• Molecular Weight: 82kDa
• NCBI Official Full Name: transient receptor potential cation channel subfamily V member 5
• NCBI Official Synonym Full Names: transient receptor potential cation channel subfamily V member 5
• NCBI Official Symbol: TRPV5
• NCBI Official Synonym Symbols: CAT2; ECAC1; OTRPC3
• NCBI Protein Information: transient receptor potential cation channel subfamily V member 5
• UniProt Protein Name: Transient receptor potential cation channel subfamily V member 5
• Protein Family: Transient receptor potential cation channel subfamily
• UniProt Gene Name: TRPV5
• UniProt Synonym Gene Names: ECAC11 PublicationManual assertion based on opinion iniRef.1; ECaC; ECaC1; OTRPC3

NCBI Description

This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. [provided by RefSeq, Jul 2008]

Uniprot Description

Constitutively active calcium selective cation channel thought to be involved in Ca2+ reabsorption in kidney and intestine (PubMed:11549322, PubMed:18768590). Required for normal Ca2+ reabsorption in the kidney distal convoluted tubules (). The channel is activated by low internal calcium level and the current exhibits an inward rectification (PubMed:11549322, PubMed:18768590). A Ca2+-dependent feedback regulation includes fast channel inactivation and slow current decay (). Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating ().