Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRPC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Rabbit TRPC6 Polyclonal Antibody | anti-TRPC6 antibody

TRPC6 antibody - N-terminal region

Gene Names
TRPC6; TRP6; FSGS2
Reactivity
Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRPC6; Polyclonal Antibody; TRPC6 antibody - N-terminal region; anti-TRPC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC
Sequence Length
931
Applicable Applications for anti-TRPC6 antibody
Western Blot (WB)
Homology
Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRPC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRPC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-TRPC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-TRPC6 antibody
This is a rabbit polyclonal antibody against TRPC6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).
Product Categories/Family for anti-TRPC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
short transient receptor potential channel 6
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily C member 6
NCBI Official Symbol
TRPC6
NCBI Official Synonym Symbols
TRP6; FSGS2
NCBI Protein Information
short transient receptor potential channel 6
UniProt Protein Name
Short transient receptor potential channel 6
UniProt Gene Name
TRPC6
UniProt Synonym Gene Names
TRP6; TrpC6; TRP-6
UniProt Entry Name
TRPC6_HUMAN

NCBI Description

The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq, Mar 2009]

Uniprot Description

TRPC6: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion. Interacts with MX1 and RNF24. Expressed primarily in placenta, lung, spleen, ovary and small intestine. Expressed in podocytes and is a component of the glomerular slit diaphragm. Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC6 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, cation; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q22.1

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding; store-operated calcium channel activity

Biological Process: positive regulation of ion transmembrane transporter activity; platelet activation; axon guidance; elevation of cytosolic calcium ion concentration; blood coagulation; positive regulation of calcium ion transport; transmembrane transport; cation transport; aging

Disease: Focal Segmental Glomerulosclerosis 2

Research Articles on TRPC6

Similar Products

Product Notes

The TRPC6 trpc6 (Catalog #AAA3214022) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPC6 antibody - N-terminal region reacts with Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRPC6 trpc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSQSPAFGPR RGSSPRGAAG AAARRNESQD YLLMDSELGE DGCPQAPLPC. It is sometimes possible for the material contained within the vial of "TRPC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.