Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Troponin T Type 3 antibody (MBS5302769) used at 1.25 ug/ml to detect target protein.)

Rabbit Troponin T Polyclonal Antibody | anti-TNNT2 antibody

Troponin T Type 3 antibody

Gene Names
TNNT2; CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Troponin T; Polyclonal Antibody; Troponin T Type 3 antibody; Polyclonal Troponin T Type 3; Anti-Troponin T Type 3; TNNT3; AMCD2B; DKFZp779M2348; FSSV; DA2B; anti-TNNT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TNNT3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
11
Applicable Applications for anti-TNNT2 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Troponin T Type 3 antibody (MBS5302769) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (Troponin T Type 3 antibody (MBS5302769) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-TNNT2 antibody
Rabbit polyclonal Troponin T Type 3 antibody
Product Categories/Family for anti-TNNT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30 kDa (MW of target protein)
NCBI Official Full Name
troponin T, partial
NCBI Official Synonym Full Names
troponin T type 2 (cardiac)
NCBI Official Symbol
TNNT2
NCBI Official Synonym Symbols
CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6
NCBI Protein Information
troponin T, cardiac muscle
UniProt Protein Name
Troponin T, cardiac muscle
Protein Family
UniProt Gene Name
TNNT2
UniProt Synonym Gene Names
TnTc; cTnT
UniProt Entry Name
TNNT2_HUMAN

NCBI Description

The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TNNT2: Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Heart. The fetal heart shows a greater expression in the atrium than in the ventricle, while the adult heart shows a greater expression in the ventricle than in the atrium. Isoform 6 predominates in normal adult heart. Isoforms 1, 7 and 8 are expressed in fetal heart. Isoform 7 is also expressed in failing adult heart. Belongs to the troponin T family. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: sarcomere; troponin complex; cytosol; striated muscle thin filament

Molecular Function: troponin C binding; structural constituent of cytoskeleton; troponin I binding; ATPase activity; tropomyosin binding; actin binding

Biological Process: regulation of muscle contraction; metabolic process; atrial cardiac muscle morphogenesis; positive regulation of ATPase activity; ventricular cardiac muscle morphogenesis; sarcomere organization; response to calcium ion; negative regulation of ATPase activity; regulation of heart contraction; muscle filament sliding

Disease: Cardiomyopathy, Familial Restrictive, 3; Cardiomyopathy, Dilated, 1d; Cardiomyopathy, Familial Hypertrophic, 2

Research Articles on TNNT2

Similar Products

Product Notes

The TNNT2 tnnt2 (Catalog #AAA5302769) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Troponin T Type 3 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Troponin T can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the TNNT2 tnnt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Troponin T, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.