Rabbit TRMT112 Polyclonal Antibody | anti-TRMT112 antibody
TRMT112 Polyclonal Antibody
Gene Names
TRMT112; TRM112; HSPC152; HSPC170; hTrm112; TRMT11-2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TRMT112; Polyclonal Antibody; TRMT112 Polyclonal Antibody; HSPC152; HSPC170; hTrm112; TRM112; TRMT11-2; anti-TRMT112 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Sequence Length
120
Applicable Applications for anti-TRMT112 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TRMT112
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-TRMT112 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13kDa/14kDa
NCBI Official Full Name
multifunctional methyltransferase subunit TRM112-like protein isoform 2
NCBI Official Synonym Full Names
tRNA methyltransferase subunit 11-2
NCBI Official Symbol
TRMT112
NCBI Official Synonym Symbols
TRM112; HSPC152; HSPC170; hTrm112; TRMT11-2
NCBI Protein Information
multifunctional methyltransferase subunit TRM112-like protein
UniProt Protein Name
Multifunctional methyltransferase subunit TRM112-like protein
UniProt Gene Name
TRMT112
Uniprot Description
Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604). Together with methyltransferase BUD23, methylates the N7 position of a guanine in 18S rRNA (PubMed:25851604). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604).
Research Articles on TRMT112
Similar Products
Product Notes
The TRMT112 trmt112 (Catalog #AAA9134315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRMT112 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRMT112 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TRMT112 trmt112 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKLLTHNLLS SHVRGVGSRG FPLRLQATEV RICPVEFNPN FVARMIPKVE WSAFLEAADN LRLIQVPKGP VEGYEENEEF LRTMHHLLLE VEVIEGTLQC PESGRMFPIS RGIPNMLLSE EETES. It is sometimes possible for the material contained within the vial of "TRMT112, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
