Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TRIOBP AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit TRIOBP Polyclonal Antibody | anti-TRIOBP antibody

TRIOBP antibody - middle region

Gene Names
TRIOBP; TARA; TAP68; DFNB28; dJ37E16.4; HRIHFB2122
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRIOBP; Polyclonal Antibody; TRIOBP antibody - middle region; anti-TRIOBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDSNKENAL
Sequence Length
431
Applicable Applications for anti-TRIOBP antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIOBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TRIOBP AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-TRIOBP AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)
Related Product Information for anti-TRIOBP antibody
This is a rabbit polyclonal antibody against TRIOBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. The protein also associates with F-actin and stabilizes F-actin structures. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness.This gene encodes a protein that interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. This trio-binding protein also associates with F-actin and stabilizes F-actin structures. Domains contained in this encoded protein are an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness. Multiple alternatively spliced transcript variants that would encode different isoforms have been found for this gene, however some transcripts may be subject to nonsense-mediated decay (NMD).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
TRIO and F-actin-binding protein isoform 2
NCBI Official Synonym Full Names
TRIO and F-actin binding protein
NCBI Official Symbol
TRIOBP
NCBI Official Synonym Symbols
TARA; TAP68; DFNB28; dJ37E16.4; HRIHFB2122
NCBI Protein Information
TRIO and F-actin-binding protein
UniProt Protein Name
TRIO and F-actin-binding protein
UniProt Gene Name
TRIOBP
UniProt Synonym Gene Names
KIAA1662; TARA
UniProt Entry Name
TARA_HUMAN

NCBI Description

This gene encodes a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. The protein also associates with F-actin and stabilizes F-actin structures. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness. Multiple alternatively spliced transcript variants that would encode different isoforms have been found for this gene, however some transcripts may be subject to nonsense-mediated decay (NMD). [provided by RefSeq, Nov 2008]

Uniprot Description

Tara: May regulate actin cytoskeletal organization, cell spreading and cell contraction by directly binding and stabilizing filamentous F-actin. The localized formation of TARA and TRIO complexes coordinates the amount of F-actin present in stress fibers. May also serve as a linker protein to recruit proteins required for F-actin formation and turnover. Defects in TRIOBP are the cause of deafness autosomal recessive type 28 (DFNB28). 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Actin-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: focal adhesion; cytoplasm; microtubule organizing center; midbody; nucleus; actin cytoskeleton

Molecular Function: actin filament binding; ubiquitin protein ligase binding; GTP-Rho binding; myosin II binding

Biological Process: mitosis; actin modification; cell division; barbed-end actin filament capping

Disease: Deafness, Autosomal Recessive 28

Research Articles on TRIOBP

Similar Products

Product Notes

The TRIOBP triobp (Catalog #AAA3202241) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIOBP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIOBP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRIOBP triobp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QIHTKDAVYT LSAMTSGIRR NWIEALRKTV RPTSAPDVTK LSDSNKENAL. It is sometimes possible for the material contained within the vial of "TRIOBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.