Western Blot (WB)
(TRIM67 antibody (MBS5303051) used at 1 ug/ml to detect target protein.)
Rabbit TRIM67 Polyclonal Antibody | anti-TRIM67 antibody
TRIM67 antibody
Gene Names
Trim67; TNL; D130049O21Rik
Applications
Western Blot
Purity
Affinity purified
Synonyms
TRIM67; Polyclonal Antibody; TRIM67 antibody; Polyclonal TRIM67; Anti-TRIM67; FLJ44831; TRIM 67; TNL; Tripartite Motif-Containing 67; TRIM-67; anti-TRIM67 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
TRIM67 antibody was raised against the C terminal of TRIM67
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIM67 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
768
Applicable Applications for anti-TRIM67 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The specific function of TRIM67 is not yet known.
Cross-Reactivity
Human
Immunogen
TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TRIM67 antibody (MBS5303051) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TRIM67 antibody (MBS5303051) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TRIM67 antibody
Rabbit polyclonal TRIM67 antibody raised against the C terminal of TRIM67
Product Categories/Family for anti-TRIM67 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
84 kDa (MW of target protein)
NCBI Official Full Name
tripartite motif-containing protein 67
NCBI Official Synonym Full Names
tripartite motif-containing 67
NCBI Official Symbol
Trim67
NCBI Official Synonym Symbols
TNL; D130049O21Rik
NCBI Protein Information
tripartite motif-containing protein 67
UniProt Protein Name
Tripartite motif-containing protein 67
Protein Family
UniProt Gene Name
Trim67
UniProt Entry Name
TRI67_MOUSE
Uniprot Description
TRIM67: Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Ubiquitin conjugating system
Cellular Component: cytoskeleton; cytoplasm; intracellular
Molecular Function: protein binding; zinc ion binding; metal ion binding
Biological Process: negative regulation of Ras protein signal transduction
Research Articles on TRIM67
Similar Products
Product Notes
The TRIM67 trim67 (Catalog #AAA5303051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRIM67 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TRIM67 trim67 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM67, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
