Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Pancreas )

Rabbit TRIM41 Polyclonal Antibody | anti-TRIM41 antibody

TRIM41 antibody - C-terminal region

Gene Names
TRIM41; RINCK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRIM41; Polyclonal Antibody; TRIM41 antibody - C-terminal region; anti-TRIM41 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLG
Sequence Length
630
Applicable Applications for anti-TRIM41 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM41
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Pancreas )

Immunohistochemistry (IHC) (Human Pancreas )

Western Blot (WB)

(WB Suggested Anti-TRIM41 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-TRIM41 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Related Product Information for anti-TRIM41 antibody
This is a rabbit polyclonal antibody against TRIM41. It was validated on Western Blot and immunohistochemistry

Target Description: The TRIM41 gene encodes a protein observed in the cytoplasm and the nucleus. Nuclear transport is mediated by an N-terminal segment common to both alpha and beta isoforms, but independent of a classical nuclear localization signal sequence.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM41 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 41
NCBI Official Symbol
TRIM41
NCBI Official Synonym Symbols
RINCK
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM41
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM41
UniProt Gene Name
TRIM41
UniProt Synonym Gene Names
RINCK; RINCK
UniProt Entry Name
TRI41_HUMAN

NCBI Description

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM family is characterized by a signature motif composed of a RING finger, one or more B-box domains, and a coiled-coil region. This encoded protein may play a role in protein kinase C signaling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

TRIM41: Functions as an E3 ligase that catalyzes the ubiquitin- mediated degradation of protein kinase C. Belongs to the TRIM/RBCC family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: cytoplasm; nucleolus

Molecular Function: protein binding; zinc ion binding; ligase activity

Biological Process: protein ubiquitination

Research Articles on TRIM41

Similar Products

Product Notes

The TRIM41 trim41 (Catalog #AAA3202083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM41 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM41 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRIM41 trim41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQSSTEQTLL SPSEKPRRFG VYLDYEAGRL GFYNAETLAH VHTFSAAFLG. It is sometimes possible for the material contained within the vial of "TRIM41, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.