Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRIM38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TRIM38 is expressed in Jurkat)

Rabbit TRIM38 Polyclonal Antibody | anti-TRIM38 antibody

TRIM38 antibody - middle region

Gene Names
TRIM38; RNF15; RORET
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM38; Polyclonal Antibody; TRIM38 antibody - middle region; anti-TRIM38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK
Sequence Length
465
Applicable Applications for anti-TRIM38 antibody
Western Blot (WB)
Homology
Guinea Pig: 90%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM38
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRIM38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TRIM38 is expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-TRIM38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that TRIM38 is expressed in Jurkat)
Related Product Information for anti-TRIM38 antibody
This is a rabbit polyclonal antibody against TRIM38. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.
Product Categories/Family for anti-TRIM38 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM38
NCBI Official Synonym Full Names
tripartite motif containing 38
NCBI Official Symbol
TRIM38
NCBI Official Synonym Symbols
RNF15; RORET
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM38
UniProt Protein Name
Tripartite motif-containing protein 38
UniProt Gene Name
TRIM38
UniProt Synonym Gene Names
RNF15; RORET
UniProt Entry Name
TRI38_HUMAN

NCBI Description

This gene encodes a member of the tripartite motif (TRIM) family. The encoded protein contains a RING-type zinc finger, B box-type zinc finger and SPRY domain. The function of this protein has not been identified. A pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Jul 2012]

Uniprot Description

TRIM38: E3 ubiquitin-protein ligase. Mediates 'Lys-48'-linked polyubiquitination and proteasomal degradation of the critical TLR adapter TICAM1, inhibiting TLR3-mediated type I interferon signaling. {ECO:0000269|PubMed:23056470}

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytosol

Molecular Function: signal transducer activity; zinc ion binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of viral genome replication; positive regulation of virion penetration into host cell; cytokine and chemokine mediated signaling pathway; positive regulation of transcription factor activity; regulation of interferon-beta production; negative regulation of defense response to virus; activation of NF-kappaB transcription factor

Research Articles on TRIM38

Similar Products

Product Notes

The TRIM38 trim38 (Catalog #AAA3202299) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM38 antibody - middle region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM38 trim38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPAVCAAVTA LQNYLTEALK AMDKMYLSNN PNSHTDNNAK SSDKEEKHRK. It is sometimes possible for the material contained within the vial of "TRIM38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.