Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TRIB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit TRIB1 Polyclonal Antibody | anti-TRIB1 antibody

TRIB1 antibody - middle region

Gene Names
TRIB1; C8FW; GIG2; TRB1; GIG-2; SKIP1; TRB-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRIB1; Polyclonal Antibody; TRIB1 antibody - middle region; anti-TRIB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
Sequence Length
372
Applicable Applications for anti-TRIB1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TRIB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-TRIB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: TRIB1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIB1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TRIB1Sample Type: COLO205Antibody Dilution: 1.0ug/mlTRIB1 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (Host: RabbitTarget Name: TRIB1Sample Type: COLO205Antibody Dilution: 1.0ug/mlTRIB1 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB)

(WB Suggested Anti-TRIB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Intestine)

Western Blot (WB) (WB Suggested Anti-TRIB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Intestine)
Related Product Information for anti-TRIB1 antibody
This is a rabbit polyclonal antibody against TRIB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
Product Categories/Family for anti-TRIB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
tribbles homolog 1 isoform 1
NCBI Official Synonym Full Names
tribbles pseudokinase 1
NCBI Official Symbol
TRIB1
NCBI Official Synonym Symbols
C8FW; GIG2; TRB1; GIG-2; SKIP1; TRB-1
NCBI Protein Information
tribbles homolog 1
UniProt Protein Name
Tribbles homolog 1
Protein Family
UniProt Gene Name
TRIB1
UniProt Synonym Gene Names
TRB-1; GIG-2
UniProt Entry Name
TRIB1_HUMAN

Uniprot Description

TRB1: Interacts with MAPK kinases and regulates activation of MAP kinases. May not display kinase activity. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Tribbles subfamily.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CAMK; CAMK group; Trbl family

Chromosomal Location of Human Ortholog: 8q24.13

Cellular Component: cytoplasm; nucleus

Molecular Function: protein kinase inhibitor activity; mitogen-activated protein kinase kinase binding; ubiquitin protein ligase binding; ubiquitin-protein ligase regulator activity; transcription factor binding; ATP binding; protein kinase activity

Biological Process: negative regulation of lipopolysaccharide-mediated signaling pathway; negative regulation of smooth muscle cell proliferation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; regulation of MAP kinase activity; negative regulation of transcription factor activity; JNK cascade; negative regulation of protein kinase activity; response to lipopolysaccharide; negative regulation of smooth muscle cell migration; protein amino acid phosphorylation

Research Articles on TRIB1

Similar Products

Product Notes

The TRIB1 trib1 (Catalog #AAA3210775) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIB1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TRIB1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRIB1 trib1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEERTQLRLE SLEDTHIMKG EDDALSDKHG CPAYVSPEIL NTTGTYSGKA. It is sometimes possible for the material contained within the vial of "TRIB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.