Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TFF2 expression in transfected 293T cell line by TFF2 polyclonal antibody. Lane 1: TFF2 transfected lysate (14.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Trefoil Factor 2 Polyclonal Antibody | anti-TFF2 antibody

Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP) (FITC)

Gene Names
TFF2; SP; SML1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Trefoil Factor 2; Polyclonal Antibody; Trefoil Factor 2 (TFF2; SML1; Spasmolysin; Spasmolytic Polypeptide; SP) (FITC); anti-TFF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TFF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-TFF2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TFF2, aa1-129 (NP_005414.1).
Immunogen Sequence
MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TFF2 expression in transfected 293T cell line by TFF2 polyclonal antibody. Lane 1: TFF2 transfected lysate (14.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TFF2 expression in transfected 293T cell line by TFF2 polyclonal antibody. Lane 1: TFF2 transfected lysate (14.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TFF2 antibody
Human spasmolytic polypeptide (HSP) is a trefoil peptide found prominently in the foveolar and surface epithelium, pyloric glands and mucous neck cells of the stomach. This antibody will help detect HSP in normal and uncharacterized tissues.
Product Categories/Family for anti-TFF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,284 Da
NCBI Official Full Name
trefoil factor 2
NCBI Official Synonym Full Names
trefoil factor 2
NCBI Official Symbol
TFF2
NCBI Official Synonym Symbols
SP; SML1
NCBI Protein Information
trefoil factor 2; spasmolysin; spasmolytic protein 1; spasmolytic polypeptide
UniProt Protein Name
Trefoil factor 2
Protein Family
UniProt Gene Name
TFF2
UniProt Synonym Gene Names
SML1; SP
UniProt Entry Name
TFF2_HUMAN

NCBI Description

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]

Uniprot Description

TFF2: Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: extracellular space

Molecular Function: protein binding; CXCR4 chemokine receptor binding

Biological Process: negative regulation of inflammatory response; positive regulation of cell proliferation; digestion; calcium-mediated signaling; negative regulation of macrophage activation; regulation of cell migration

Research Articles on TFF2

Similar Products

Product Notes

The TFF2 tff2 (Catalog #AAA6397108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Trefoil Factor 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFF2 tff2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Trefoil Factor 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.