Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Transglutaminase 6 antibody (MBS5300017) used at 0.5 ug/ml to detect target protein.)

Rabbit anti-Human, Mouse Transglutaminase 6 Polyclonal Antibody | anti-TGM6 antibody

Transglutaminase 6 antibody

Gene Names
TGM6; TG6; TGY; SCA35; TGM3L; dJ734P14.3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
Transglutaminase 6; Polyclonal Antibody; Transglutaminase 6 antibody; Polyclonal Transglutaminase 6; Anti-Transglutaminase 6; Transglutaminase -6; TGY; TGM6; TGM3L; dJ734P14.3; anti-TGM6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
Transglutaminase 6 antibody was raised against the middle region of TGM6
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGM6 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
905
Applicable Applications for anti-TGM6 antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
TGM6 belongs to the transglutaminase superfamily and catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
Cross-Reactivity
Human,Mouse
Immunogen
Transglutaminase 6 antibody was raised using the middle region of TGM6 corresponding to a region with amino acids KKIGRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEAS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Transglutaminase 6 antibody (MBS5300017) used at 0.5 ug/ml to detect target protein.)

Western Blot (WB) (Transglutaminase 6 antibody (MBS5300017) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-TGM6 antibody
Rabbit polyclonal Transglutaminase 6 antibody raised against the middle region of TGM6
Product Categories/Family for anti-TGM6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
69 kDa (MW of target protein)
NCBI Official Full Name
transglutaminase 6, partial
NCBI Official Synonym Full Names
transglutaminase 6
NCBI Official Symbol
TGM6
NCBI Official Synonym Symbols
TG6; TGY; SCA35; TGM3L; dJ734P14.3
NCBI Protein Information
protein-glutamine gamma-glutamyltransferase 6
UniProt Protein Name
Protein-glutamine gamma-glutamyltransferase 6
UniProt Gene Name
TGM6
UniProt Synonym Gene Names
TGM3L; TGY; TGase Y; TGase-3-like; TG6; TGase-6
UniProt Entry Name
TGM3L_HUMAN

NCBI Description

The protein encoded by this gene belongs to the transglutaminase superfamily. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Mutations in this gene are associated with spinocerebellar ataxia type 35 (SCA35). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

TGM6: an enzyme of the transglutaminase family that catalyzes the crosslinking of proteins and the conjugation of polyamines to proteins. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. Two alternatively spliced isoforms have been described.

Protein type: Transferase; EC 2.3.2.13

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: cytoplasm

Molecular Function: protein-glutamine gamma-glutamyltransferase activity; metal ion binding

Biological Process: peptide cross-linking

Disease: Spinocerebellar Ataxia 35

Research Articles on TGM6

Similar Products

Product Notes

The TGM6 tgm6 (Catalog #AAA5300017) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Transglutaminase 6 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Transglutaminase 6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the TGM6 tgm6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Transglutaminase 6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.