Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Human Hela cell lysate; Primary Ab: 2ug/mL Rabbit Anti-Porcine TFR Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Rabbit anti-Pig Transferrin Receptor (TFR) Polyclonal Antibody | anti-TFR antibody

Polyclonal Antibody to Transferrin Receptor (TFR)

Gene Names
TFRC; trfr
Reactivity
Pig
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Transferrin Receptor (TFR); Polyclonal Antibody; Polyclonal Antibody to Transferrin Receptor (TFR); anti-TFR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Pig
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against TFR. It has been selected for its ability to recognize TFR in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MDT YDVLSKRVPQ LNRMARAAAE VAGHLVIKLT IDFELNLNYE MYNDKILSFV REMNQFRVDI REMGLSLQWL YSARGDFFRA TSRLTSDYRN VETRDKFVMR EINDRIMKVE YHFLSPYVSP RESPFRHIFW GSGSHTLSAL VEHLKLRQKN SSAFNQTLLK NQLALATWTI QGAANALSGD IWDID
Sequence Length
760
Applicable Applications for anti-TFR antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant TFR (Met578~Asp765) expressed in E.coli.
Cross Reactivity
Pig
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2052131
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Human Hela cell lysate; Primary Ab: 2ug/mL Rabbit Anti-Porcine TFR Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Western Blot (WB) (Western Blot: Sample: Human Hela cell lysate; Primary Ab: 2ug/mL Rabbit Anti-Porcine TFR Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,122 Da
NCBI Official Full Name
transferrin receptor protein 1
NCBI Official Symbol
TFRC
NCBI Official Synonym Symbols
trfr
NCBI Protein Information
transferrin receptor protein 1
UniProt Protein Name
Transferrin receptor protein 1
UniProt Gene Name
TFRC
UniProt Synonym Gene Names
TR; TfR; TfR1; Trfr

Uniprot Description

Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (). Positively regulates T and B cell proliferation through iron uptake ().

Research Articles on TFR

Similar Products

Product Notes

The TFR tfrc (Catalog #AAA2004261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Transferrin Receptor (TFR) reacts with Pig and may cross-react with other species as described in the data sheet. AAA Biotech's Transferrin Receptor (TFR) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the TFR tfrc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-MDT YDVLSKRVPQ LNRMARAAAE VAGHLVIKLT IDFELNLNYE MYNDKILSFV REMNQFRVDI REMGLSLQWL YSARGDFFRA TSRLTSDYRN VETRDKFVMR EINDRIMKVE YHFLSPYVSP RESPFRHIFW GSGSHTLSAL VEHLKLRQKN SSAFNQTLLK NQLALATWTI QGAANALSGD IWDID. It is sometimes possible for the material contained within the vial of "Transferrin Receptor (TFR), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.