Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Mouse GSC Monoclonal Antibody | anti-GSC antibody

GSC (goosecoid Homeobox) (FITC)

Gene Names
GSC; SAMS
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
GSC; Monoclonal Antibody; GSC (goosecoid Homeobox) (FITC); goosecoid Homeobox; anti-GSC antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H7
Specificity
Recognizes GSC.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-GSC antibody
Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GSC (NP_776248, 151aa-257aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged GSC is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GSC is approximately 0.1ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSC MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSC MaxPab rabbit polyclonal antibody.)

Western Blot (WB)

(Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M01), clone 4H7.Lane 1: GSC transfected lysate (28.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M01), clone 4H7.Lane 1: GSC transfected lysate (28.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-GSC antibody
This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. [provided by RefSeq]
Product Categories/Family for anti-GSC antibody
References
1. Generation of pluripotent stem cells from adult human testis. Conrad S, Renninger M, Hennenlotter J, Wiesner T, Just L, Bonin M, Aicher W, Buhring HJ, Mattheus U, Mack A, Wagner HJ, Minger S, Matzkies M, Reppel M, Hescheler J, Sievert KD, Stenzl A, Skutella T.Nature. 2008 Nov 20;456(7220):344-9. Epub 2008 Oct 8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,150 Da
NCBI Official Full Name
homeobox protein goosecoid
NCBI Official Synonym Full Names
goosecoid homeobox
NCBI Official Symbol
GSC
NCBI Official Synonym Symbols
SAMS
NCBI Protein Information
homeobox protein goosecoid
UniProt Protein Name
Homeobox protein goosecoid
Protein Family
UniProt Gene Name
GSC
UniProt Entry Name
GSC_HUMAN

Similar Products

Product Notes

The GSC gsc (Catalog #AAA6178499) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GSC can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSC gsc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.