Transferrin Polyclonal Antibody | anti-TF antibody

Anti-Transferrin Antibody

Cat. Num. AAA178119

• Gene Names: TF; TFQTL1; PRO1557; PRO2086; HEL-S-71p
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Transferrin; Polyclonal Antibody; Anti-Transferrin Antibody; Serotransferrin; Apotransferrin; Beta 1 metal binding globulin; Beta-1 metal-binding globulin; DKFZp781D0156; PRO1400; PRO1557; PRO2086; Serotransferrin precursor; Siderophilin; TF; TFQTL1; Transferin; transferrin; anti-TF antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 698

• Applicable Applications for anti-TF antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Transferrin Picoband antibody, MBS178119, Western blottingAll lanes: Anti Transferrin (MBS178119) at 0.5ug/mlLane 1: Rat Thymus Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugPredicted bind size: 77KDObserved bind size: 77KD )

Immunohistochemistry (IHC)

(Anti- Transferrin Picoband antibody, MBS178119,IHC(P)IHC(P): Mouse Liver Tissue)

Immunohistochemistry (IHC)

(Anti- Transferrin Picoband antibody, MBS178119,IHC(P)IHC(P): Rat Liver Tissue)

Immunohistochemistry (IHC)

(Anti- Transferrin Picoband antibody, MBS178119,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

Related Product Information for anti-TF antibody

Description: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1% (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 Mˆ'1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

References

1. Asada-Senju, M., Maeda, T., Sakata, T., Hayashi, A., Suzuki, T.Molecular analysis of the transferrin gene in a patient with hereditary hypotransferrinemia.J. Hum. Genet. 47: 355-359, 2002. 2. Delanghe, J., Verstraelen, H., Pynaert, I., Debels, L., Taes, Y., Verhasselt, B., De Henauw, S., Temmerman, M.Human transferrin G277S mutation and iron deficiency in pregnancy. (Letter)Brit. J. Haemat. 132: 249-250, 2005. 3. Pang, H., Koda, Y., Soejima, M., Kimura, H.Identification of a mutation (A1879G) of transferrin from cDNA prepared from peripheral blood cells.Ann. Hum. Genet. 62: 271-274, 1998.

NCBI and Uniprot Product Information

• NCBI GI #: 4557871
• NCBI GeneID: 7018
• NCBI Accession #: NP_001054.1
• NCBI GenBank Nucleotide #: NM_001063.3
• UniProt Accession #: P02787; O43890; Q1HBA5; Q9NQB8; Q9UHV0
• Molecular Weight: 77,064 Da
• NCBI Official Full Name: serotransferrin
• NCBI Official Synonym Full Names: transferrin
• NCBI Official Symbol: TF
• NCBI Official Synonym Symbols: TFQTL1; PRO1557; PRO2086; HEL-S-71p
• NCBI Protein Information: serotransferrin
• UniProt Protein Name: Serotransferrin
• Protein Family: Transferrin
• UniProt Gene Name: TF
• UniProt Synonym Gene Names: Transferrin
• UniProt Entry Name: TRFE_HUMAN

NCBI Description

This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq, Sep 2009]

Uniprot Description

TF: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. Defects in TF are the cause of atransferrinemia (ATRAF). Atransferrinemia is rare autosomal recessive disorder characterized by iron overload and hypochromic anemia. Belongs to the transferrin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: apical plasma membrane; basal plasma membrane; cell surface; coated pit; cytoplasmic membrane-bound vesicle; early endosome; endocytic vesicle; endosome membrane; extracellular region; extracellular space; extrinsic to external side of plasma membrane; late endosome; perinuclear region of cytoplasm; recycling endosome; vesicle

Molecular Function: ferric iron binding; ferric iron transmembrane transporter activity; ferrous iron binding; protein binding

Biological Process: cellular iron ion homeostasis; iron ion homeostasis; platelet degranulation; positive regulation of receptor-mediated endocytosis; regulation of protein stability; retinal homeostasis; transferrin transport

Disease: Atransferrinemia