Western Blot (WB)
(Western blot analysis of extracts of mouse brain, using TRAK1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human, Rat TRAK1 Polyclonal Antibody | anti-TRAK1 antibody
TRAK1 Polyclonal Antibody
Gene Names
TRAK1; MILT1; OIP106
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TRAK1; Polyclonal Antibody; TRAK1 Polyclonal Antibody; MILT1; OIP106; anti-TRAK1 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLQELAEKGELRSGSLTPTESIMSLGTHSRFSEFTGFSGMSFSSRS
Sequence Length
953
Applicable Applications for anti-TRAK1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TRAK1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Early endosome, Endosome, Mitochondrion, Nucleus
Positive Samples
mouse brain, rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of mouse brain, using TRAK1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of mouse brain, using TRAK1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of rat brain, using TRAK1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Western Blot (WB)
(Western blot analysis of extracts of rat brain, using TRAK1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Product Categories/Family for anti-TRAK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 63kDa; 77kDa; 106kDa
Observed: 130kDa
Observed: 130kDa
NCBI Official Full Name
trafficking kinesin-binding protein 1 isoform 1
NCBI Official Synonym Full Names
trafficking kinesin protein 1
NCBI Official Symbol
TRAK1
NCBI Official Synonym Symbols
MILT1; OIP106
NCBI Protein Information
trafficking kinesin-binding protein 1
UniProt Protein Name
Trafficking kinesin-binding protein 1
Protein Family
UniProt Gene Name
TRAK1
UniProt Synonym Gene Names
KIAA1042; OIP106
Uniprot Description
Involved in the regulation of endosome-to-lysosome trafficking, including endocytic trafficking of EGF-EGFR complexes and GABA-A receptors.
Research Articles on TRAK1
Similar Products
Product Notes
The TRAK1 trak1 (Catalog #AAA9135235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAK1 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRAK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TRAK1 trak1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LEEAESPDIT HQKRVFETVR NINQVVKQRS LTPSPMNIPG SNQSSAMNSL LSSCVSTPRS SFYGSDIGNV VLDNKTNSII LETEAADLGN DERSKKPGTP GTPGSHDLET ALRRLSLRRE NYLSERRFFE EEQERKLQEL AEKGELRSGS LTPTESIMSL GTHSRFSEFT GFSGMSFSSR S. It is sometimes possible for the material contained within the vial of "TRAK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
