Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRAF3IP3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTRAF3IP3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit TRAF3IP3 Polyclonal Antibody | anti-TRAF3IP3 antibody

TRAF3IP3 antibody - middle region

Gene Names
TRAF3IP3; T3JAM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRAF3IP3; Polyclonal Antibody; TRAF3IP3 antibody - middle region; anti-TRAF3IP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS
Sequence Length
531
Applicable Applications for anti-TRAF3IP3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRAF3IP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRAF3IP3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTRAF3IP3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-TRAF3IP3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTRAF3IP3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-TRAF3IP3 antibody
This is a rabbit polyclonal antibody against TRAF3IP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
Product Categories/Family for anti-TRAF3IP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
TRAF3-interacting JNK-activating modulator isoform 1
NCBI Official Synonym Full Names
TRAF3 interacting protein 3
NCBI Official Symbol
TRAF3IP3
NCBI Official Synonym Symbols
T3JAM
NCBI Protein Information
TRAF3-interacting JNK-activating modulator
UniProt Protein Name
TRAF3-interacting JNK-activating modulator
UniProt Gene Name
TRAF3IP3
UniProt Synonym Gene Names
T3JAM
UniProt Entry Name
T3JAM_HUMAN

NCBI Description

The gene encodes a protein that mediates cell growth by modulating the c-Jun N-terminal kinase signal transduction pathway. The encoded protein may also interact with a large multi-protein assembly containing the phosphatase 2A catalytic subunit. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

TRAF3IP3: May function as an adapter molecule that regulates TRAF3-mediated JNK activation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: integral to membrane

Molecular Function: protein binding

Research Articles on TRAF3IP3

Similar Products

Product Notes

The TRAF3IP3 traf3ip3 (Catalog #AAA3209710) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAF3IP3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRAF3IP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRAF3IP3 traf3ip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQKMVILQDL LSTLIQASDS SWKGQLNEDK LKGKLRSLEN QLYTCTQKYS. It is sometimes possible for the material contained within the vial of "TRAF3IP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.