Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TPH2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit TPH2 Polyclonal Antibody | anti-TPH2 antibody

TPH2 antibody - N-terminal region

Gene Names
TPH2; NTPH; ADHD7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TPH2; Polyclonal Antibody; TPH2 antibody - N-terminal region; anti-TPH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS
Sequence Length
490
Applicable Applications for anti-TPH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TPH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TPH2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-TPH2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-TPH2 antibody
This is a rabbit polyclonal antibody against TPH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Tryptophan hydroxylase (TPH; EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.
Product Categories/Family for anti-TPH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
tryptophan 5-hydroxylase 2
NCBI Official Synonym Full Names
tryptophan hydroxylase 2
NCBI Official Symbol
TPH2
NCBI Official Synonym Symbols
NTPH; ADHD7
NCBI Protein Information
tryptophan 5-hydroxylase 2
UniProt Protein Name
Tryptophan 5-hydroxylase 2
Protein Family
UniProt Gene Name
TPH2
UniProt Synonym Gene Names
NTPH
UniProt Entry Name
TPH2_HUMAN

NCBI Description

This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression. [provided by RefSeq, Feb 2016]

Uniprot Description

TPH2: an enzyme that is rate-limiting in the biosynthesis of serotonin. It catalyzes the biopterin dependent monooxygenation of tryptophan to 5-hydroxytryptophan (5HT), which is subsequently decarboxylated to form the neurotransmitter serotonin. Its expression is limited to a few specialized tissues: raphe neurons, pinealocytes, mast cells, mononuclear leukocytes, beta-cells of the islets of Langerhans, and intestinal and pancreatic enterochromaffin cells. Two alternatively spliced isoforms have been described. Isoform 2 appears to be expressed exclusively in the brain, and is expressed at significantly higher levels in the raphe nuclei than isoform 1.

Protein type: Amino Acid Metabolism - tryptophan; Oxidoreductase; EC 1.14.16.4

Chromosomal Location of Human Ortholog: 12q21.1

Cellular Component: neuron projection; cytosol

Molecular Function: amino acid binding; tryptophan 5-monooxygenase activity; iron ion binding

Biological Process: response to nutrient levels; circadian rhythm; indolalkylamine biosynthetic process; aromatic amino acid family metabolic process; response to estrogen stimulus; response to glucocorticoid stimulus; response to activity; response to calcium ion; serotonin biosynthetic process

Disease: Major Depressive Disorder; Attention Deficit-hyperactivity Disorder, Susceptibility To, 7

Research Articles on TPH2

Similar Products

Product Notes

The TPH2 tph2 (Catalog #AAA3201884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPH2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TPH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TPH2 tph2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REAATESGKT AVVFSLKNEV GGLVKALRLF QEKRVNMVHI ESRKSRRRSS. It is sometimes possible for the material contained within the vial of "TPH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.