Immunohistochemistry (IHC)
(rat and mouse brain)
Rabbit TH Polyclonal Antibody | anti-TH antibody
TH antibody - N-terminal region
Gene Names
TH; TYH; DYT14; DYT5b
Reactivity
Cow, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TH; Polyclonal Antibody; TH antibody - N-terminal region; anti-TH antibody
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQSPRFIGRRQSLIEDAR
Sequence Length
407
Applicable Applications for anti-TH antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 90%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human TH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(rat and mouse brain)
Immunohistochemistry (IHC)
(rat and mouse brain)
Western Blot (WB)
(WB Suggested Anti-TH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-TH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-TH antibody
This is a rabbit polyclonal antibody against TH. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Plays an important role in the physiology of adrenergic neurons. Tyrosine hydroxylase is involved in the conversion of tyrosine to dopamine. As the rate-limiting enzyme in the synthesis of catecholamines, tyrosine hydroxylase has a key role in the physiology of adrenergic neurons.
Target Description: Plays an important role in the physiology of adrenergic neurons. Tyrosine hydroxylase is involved in the conversion of tyrosine to dopamine. As the rate-limiting enzyme in the synthesis of catecholamines, tyrosine hydroxylase has a key role in the physiology of adrenergic neurons.
Product Categories/Family for anti-TH antibody
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008]
Research Articles on TH
1. conserved regions recruit transcription factors that are established regulators of Th transcription
Similar Products
Product Notes
The TH (Catalog #AAA3224337) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TH antibody - N-terminal region reacts with Cow, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TH can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPTPDATTPQ AKGFRRAVSE LDAKQAEAIM VRGQSPRFIG RRQSLIEDAR. It is sometimes possible for the material contained within the vial of "TH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
