Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Mouse retinaApplication: ImmunofluorescenceSpecies+tissue/cell type: Mouse retinaPrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexafluor 568Secondary antibody dilution: 1:200)

Rabbit TPD52 Polyclonal Antibody | anti-TPD52 antibody

TPD52 antibody - middle region

Gene Names
TPD52; D52; N8L; PC-1; PrLZ; hD52
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TPD52; Polyclonal Antibody; TPD52 antibody - middle region; anti-TPD52 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG
Sequence Length
224
Applicable Applications for anti-TPD52 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TPD52
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Mouse retinaApplication: ImmunofluorescenceSpecies+tissue/cell type: Mouse retinaPrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexafluor 568Secondary antibody dilution: 1:200)

Immunohistochemistry (IHC) (Sample Type: Mouse retinaApplication: ImmunofluorescenceSpecies+tissue/cell type: Mouse retinaPrimary antibody dilution: 1:200Secondary antibody: Goat anti-rabbit Alexafluor 568Secondary antibody dilution: 1:200)

Western Blot (WB)

(WB Suggested Anti-TPD52 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateTPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-TPD52 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateTPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-TPD52 antibody
This is a rabbit polyclonal antibody against TPD52. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: It belongs to the TPD52 family. Its exact function remains unknown.
Product Categories/Family for anti-TPD52 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
tumor protein D52 isoform 1
NCBI Official Synonym Full Names
tumor protein D52
NCBI Official Symbol
TPD52
NCBI Official Synonym Symbols
D52; N8L; PC-1; PrLZ; hD52
NCBI Protein Information
tumor protein D52
UniProt Protein Name
Tumor protein D52
Protein Family
UniProt Gene Name
TPD52
UniProt Entry Name
TPD52_HUMAN

Uniprot Description

TPD52: a coiled-coil motif bearing hydrophilic protein known to be overexpressed in many human solid tumors of diverse cellular origins. May be associated with B cell differentiation. Increased expression is associated with increased proliferation and invasive capacity in different cell types. May negatively regulate ATM protein levels. Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary. Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney. Eight isoforms of the human protein are produced by alternative splicing

Protein type: Endoplasmic reticulum; Calcium-binding

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity; calcium ion binding

Biological Process: anatomical structure morphogenesis; secretion; B cell differentiation; positive regulation of cell proliferation

Research Articles on TPD52

Similar Products

Product Notes

The TPD52 tpd52 (Catalog #AAA3208950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPD52 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TPD52 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TPD52 tpd52 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGQKASAAFS SVGSVITKKL EDVKNSPTFK SFEEKVENLK SKVGGTKPAG. It is sometimes possible for the material contained within the vial of "TPD52, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.