Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '18179'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.71 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '18179' and pd.language_id = 1
Query
Database
1.53 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '18179'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
1.9 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '18179'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '18179' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '18179'
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value['specificity']
This assay has high sensitivity and excellent specificity for detection of human AOAH. No significant cross-reactivity or interference between human AOAH and analogues was observed.
⇄purity => string (3) "N/A"
$value['purity']
⇄form => string (3) "N/A"
$value['form']
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
Samples||Serum, plasma, tissue homogenates, cell lysates!!Assay Type||Quantitative Sandwich!!Detection Range||0.156 ng/ml-10 ng/ml!!Sensitivity||Typically less than 0.039 ng/ml.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for AOAH has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any AOAH present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for AOAH is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of AOAH bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value->a['specificity']
This assay has high sensitivity and excellent specificity for detection of human AOAH. No significant cross-reactivity or interference between human AOAH and analogues was observed.
⇄purity => string (3) "N/A"
$value->a['purity']
⇄form => string (3) "N/A"
$value->a['form']
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value->a['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
Samples||Serum, plasma, tissue homogenates, cell lysates!!Assay Type||Quantitative Sandwich!!Detection Range||0.156 ng/ml-10 ng/ml!!Sensitivity||Typically less than 0.039 ng/ml.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value->a['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value->a['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for AOAH has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any AOAH present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for AOAH is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of AOAH bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value->d['specificity']
This assay has high sensitivity and excellent specificity for detection of human AOAH. No significant cross-reactivity or interference between human AOAH and analogues was observed.
⇄purity => string (3) "N/A"
$value->d['purity']
⇄form => string (3) "N/A"
$value->d['form']
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value->d['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
Samples||Serum, plasma, tissue homogenates, cell lysates!!Assay Type||Quantitative Sandwich!!Detection Range||0.156 ng/ml-10 ng/ml!!Sensitivity||Typically less than 0.039 ng/ml.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value->d['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value->d['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for AOAH has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any AOAH present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for AOAH is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of AOAH bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄specificity => string (23) "Recognizes human HNF4A."
$value[0]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[0]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[0]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[0]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[0]['_source']['app_tested']
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[0]['_source']['app_notes']
⇄⧉testing_protocols => string (1089) "WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell li...
$value[0]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA25126_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.||AAA25126_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml]||AAA25126_IF5.jpg!!WB (Western Blot)||Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.||AAA25126_WB4.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.||AAA25126_WB3.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2||AAA25126_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.74kD).||AAA25126_WB.jpg
⇄⧉etc_term1 => string (272) "Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (...
$value[0]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP!!Conjugate||FITC
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (FITC)
⇄products_name_syn => string (3) "N/A"
$value[0]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HNF4A"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[0]['_source']['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value[0]['_source']['products_description']
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[0]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉search_terms => string (1358) "aaa25126 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity c...
$value[0]['_source']['search_terms']
aaa25126 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes hnf4a elisa eia immunofluorescence if western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.74kd aaa25126_wb analysis of expression hepg2 aaa25126_wb2 jurkat aaa25126_wb3 transfected 293t cell line lane 1 lysate 51.6kd 2 non aaa25126_wb4 to hela concentration aaa25126_if5 testing data limit for recombinant gst tagged is ~1ng capture aaa25126_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25126_wb7 hepatocyte nuclear factor 4 alpha hnf transcription receptor subfamily group member 14 hnf4 nr2a1 tcf14 isoform hnf4alpha2 tcf mody frts4 mody1 hnf4a7 hnf4a8 hnf4a9 nr2a21 hnf4alpha hnf4alpha10 11 12 hepatic 43,988 da hnf4a_human 31077205 np_000448 p41235 nm_000457 a5jw41 o00659 o00723 q14540 q5qpb8 q6b4v5 q6b4v6 q6b4v7 q92653 q92654 b2rpp8 125850 antibodies factors partial corresponding aa324 423 from tag mw the alone 26kd sequence ndrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggspsdaphahhplhphlmqehmgtnvivantmpthlsngqmcewprp conjugate igg2a,k4e2 ph7.2 lane1 51.6kd2 expressed293 factor4 member14 hnf4alpha1011 aa324423
⇄specificity => string (23) "Recognizes human HNF4A."
$value[1]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[1]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[1]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[1]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[1]['_source']['app_tested']
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[1]['_source']['app_notes']
⇄⧉testing_protocols => string (1089) "WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell li...
$value[1]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA25715_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.||AAA25715_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml]||AAA25715_IF5.jpg!!WB (Western Blot)||Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.||AAA25715_WB4.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.||AAA25715_WB3.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2||AAA25715_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.74kD).||AAA25715_WB.jpg
⇄⧉etc_term1 => string (270) "Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (...
$value[1]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP!!Conjugate||PE
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (PE)
⇄products_name_syn => string (3) "N/A"
$value[1]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HNF4A"
$value[1]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[1]['_source']['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value[1]['_source']['products_description']
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[1]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉search_terms => string (1345) "aaa25715 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity c...
$value[1]['_source']['search_terms']
aaa25715 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes hnf4a elisa eia immunofluorescence if western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.74kd aaa25715_wb analysis of expression hepg2 aaa25715_wb2 jurkat aaa25715_wb3 transfected 293t cell line lane 1 lysate 51.6kd 2 non aaa25715_wb4 to hela concentration aaa25715_if5 testing data limit for recombinant gst tagged is ~1ng capture aaa25715_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25715_wb7 hepatocyte nuclear factor 4 alpha hnf transcription receptor subfamily group member 14 hnf4 nr2a1 tcf14 isoform hnf4alpha2 tcf mody frts4 mody1 hnf4a7 hnf4a8 hnf4a9 nr2a21 hnf4alpha hnf4alpha10 11 12 hepatic 43,988 da hnf4a_human 31077205 np_000448 p41235 nm_000457 a5jw41 o00659 o00723 q14540 q5qpb8 q6b4v5 q6b4v6 q6b4v7 q92653 q92654 b2rpp8 125850 antibodies factors partial corresponding aa324 423 from tag mw the alone 26kd sequence ndrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggspsdaphahhplhphlmqehmgtnvivantmpthlsngqmcewprp conjugate igg2a,k4e2 ph7.2 lane1 51.6kd2 expressed293 factor4 member14 hnf4alpha1011 aa324423
⇄specificity => string (23) "Recognizes human HNF4A."
$value[2]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[2]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[2]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[2]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[2]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[2]['_source']['app_notes']
⇄⧉testing_protocols => string (1089) "WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell li...
$value[2]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA25420_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.||AAA25420_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml]||AAA25420_IF5.jpg!!WB (Western Blot)||Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.||AAA25420_WB4.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.||AAA25420_WB3.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2||AAA25420_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.74kD).||AAA25420_WB.jpg
⇄⧉etc_term1 => string (271) "Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (...
$value[2]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP!!Conjugate||HRP
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (HRP)
⇄products_name_syn => string (3) "N/A"
$value[2]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HNF4A"
$value[2]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[2]['_source']['products_gene_name_syn']
⇄⧉products_description => string (565) "The protein encoded by this gene is a nuclear transcription factor which bin...
$value[2]['_source']['products_description']
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[2]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉search_terms => string (1353) "aaa25420 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity c...
$value[2]['_source']['search_terms']
aaa25420 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes hnf4a elisa eia western blot wb applications are based on unconjugated antibody detection against immunogen 36.74kd aaa25420_wb analysis of expression hepg2 aaa25420_wb2 jurkat aaa25420_wb3 transfected 293t cell line lane 1 lysate 51.6kd 2 non aaa25420_wb4 immunofluorescence if to hela concentration 10ug ml aaa25420_if5 testing data limit for recombinant gst tagged is ~1ng capture aaa25420_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25420_wb7 hepatocyte nuclear factor 4 alpha hnf transcription receptor subfamily group member 14 hnf4 nr2a1 tcf14 isoform hnf4alpha2 tcf mody frts4 mody1 hnf4a7 hnf4a8 hnf4a9 nr2a21 hnf4alpha hnf4alpha10 11 12 hepatic 43,988 da hnf4a_human 31077205 np_000448 p41235 nm_000457 a5jw41 o00659 o00723 q14540 q5qpb8 q6b4v5 q6b4v6 q6b4v7 q92653 q92654 b2rpp8 125850 antibodies factors partial corresponding aa324 423 from tag mw the alone 26kd sequence ndrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggspsdaphahhplhphlmqehmgtnvivantmpthlsngqmcewprp conjugate igg2a,k4e2 ph7.2 lane1 51.6kd2 expressed293 factor4 member14 hnf4alpha1011 aa324423
Homology||Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%!!Immunogen||The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A
⇄⧉products_description => string (713) "This is a rabbit polyclonal antibody against HNF4A. It was validated on West...
$value[3]['_source']['products_description']
This is a rabbit polyclonal antibody against HNF4A. It was validated on Western Blot<br><br>Target Description: The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[3]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉products_categories => string (213) "Polyclonal; Transcription Factor; Transcription Regulation; Drugs and Drug M...
$value[3]['_source']['products_categories']
Polyclonal; Transcription Factor; Transcription Regulation; Drugs and Drug Metabolism; Cell Biology; Chromatin & Nuclear Signaling; Signal Transduction; Phosphorylation; Transcription Factors; Cell Differentiation
AMPK Signaling Pathway||198868!!Developmental Biology Pathway||477129!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Gene Expression Pathway||105937!!Generic Transcription Pathway||105938!!HIF-1-alpha Transcription Factor Network Pathway||138045!!Integrated Pancreatic Cancer Pathway||711360!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Nuclear Receptor Transcription Pathway||105979
⇄⧉search_terms => string (1012) "aaa23401 rabbit cow dog guinea pig horse human mouse rat sheep zebrafish pol...
$value[3]['_source']['search_terms']
aaa23401 rabbit cow dog guinea pig horse human mouse rat sheep zebrafish polyclonal affinity purified liquid antibody supplied in 1x pbs buffer with 0.09 w v sodium azide and 2 sucrose western blot wb host target name hnf4a sample tissue lung tumor dilution 1.0ug ml aaa23401_wb type fetal heart aaa23401_wb2 aaa23401_wb3 skeletal muscle 1ug aaa23401_wb4 suggested anti titration 0.2 1 ug a blocking peptide b + aaa23401_wb5 liver aaa23401_wb6 synthetic located within the following region mrlsktlvdmdmadysaaldpayttlefenvqvltmgndtspsegtnlna n terminal hnf4 hnf4a7 hnf4a8 hnf4a9 hnf4alpha mody mody1 nr2a1 nr2a21 tcf tcf14 hepatocyte nuclear factor 4 alpha isoform frts4 53kda receptor subfamily group member transcription 14 hnf hnf4a_human 31077205 np_000448 p41235 nm_000457 125850 regulation drugs drug metabolism cell biology chromatin signaling signal transduction phosphorylation factors differentiation homology 100 93 immunogen is directed towards of and2 titration0.2 factor4 transcription14 homology100
⇄specificity => string (23) "Recognizes human HNF4A."
$value[4]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[4]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[4]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[4]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[4]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[4]['_source']['app_notes']
⇄⧉testing_protocols => string (1089) "WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell li...
$value[4]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA24238_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.||AAA24238_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml]||AAA24238_IF5.jpg!!WB (Western Blot)||Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.||AAA24238_WB4.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.||AAA24238_WB3.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2||AAA24238_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.74kD).||AAA24238_WB.jpg
⇄⧉etc_term1 => string (270) "Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (...
$value[4]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP!!Conjugate||AP
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (AP)
⇄products_name_syn => string (3) "N/A"
$value[4]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HNF4A"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value[4]['_source']['products_description']
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[4]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉search_terms => string (1350) "aaa24238 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity c...
$value[4]['_source']['search_terms']
aaa24238 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes hnf4a elisa eia western blot wb applications are based on unconjugated antibody detection against immunogen 36.74kd aaa24238_wb analysis of expression hepg2 aaa24238_wb2 jurkat aaa24238_wb3 transfected 293t cell line lane 1 lysate 51.6kd 2 non aaa24238_wb4 immunofluorescence if to hela concentration 10ug ml aaa24238_if5 testing data limit for recombinant gst tagged is ~1ng capture aaa24238_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24238_wb7 hepatocyte nuclear factor 4 alpha hnf transcription receptor subfamily group member 14 hnf4 nr2a1 tcf14 isoform hnf4alpha2 tcf mody frts4 mody1 hnf4a7 hnf4a8 hnf4a9 nr2a21 hnf4alpha hnf4alpha10 11 12 hepatic 43,988 da hnf4a_human 31077205 np_000448 p41235 nm_000457 a5jw41 o00659 o00723 q14540 q5qpb8 q6b4v5 q6b4v6 q6b4v7 q92653 q92654 b2rpp8 125850 antibodies factors partial corresponding aa324 423 from tag mw the alone 26kd sequence ndrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggspsdaphahhplhphlmqehmgtnvivantmpthlsngqmcewprp conjugate igg2a,k4e2 ph7.2 lane1 51.6kd2 expressed293 factor4 member14 hnf4alpha1011 aa324423
⇄⧉testing_protocols => string (1242) "FCM (Flow Cytometry)||Flow cytometric analysis of HepG2 cells with HNF-4-alp...
$value[5]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of HepG2 cells with HNF-4-alpha antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody||AAA30162_FCM6.jpg!!ICC (Immunocytochemistry)||ICC staining HNF-4-alpha in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30162_ICC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-HNF-4-alpha antibody. Counter stained with hematoxylin.||AAA30162_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-HNF-4-alpha antibody. Counter stained with hematoxylin.||AAA30162_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon cancer tissue using anti-HNF-4-alpha antibody. Counter stained with hematoxylin.||AAA30162_IHC2.jpg!!WB (Western Blot)||Western blot analysis of HNF-4-alpha on human kidney lysates using anti-HNF-4-alpha antibody at 1/1, 000 dilution.||AAA30162_WB.jpg
⇄⧉products_description => string (513) "HNF-4 alpha is a transcription factor that binds DNA as a homodimer. HNF-4 a...
$value[5]['_source']['products_description']
HNF-4 alpha is a transcription factor that binds DNA as a homodimer. HNF-4 alpha is important in liver, kidney, and intestinal development. It has also been intensely studied as one of a variety of genes responsible for diabetes mellitus. HNF-4 alpha has been shown in knock out mice to be essential for the morphogenic and functional differentiation of hepatocytes. HNF-4 alpha is a dominant regulator of epithelial phenotypes able to drive the mesenchymal-to-epithelial transition when expressed in fibroblasts.
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[5]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄products_categories => string (16) "Total protein Ab"
AMPK Signaling Pathway||198868!!Developmental Biology Pathway||477129!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Gene Expression Pathway||105937!!Generic Transcription Pathway||105938!!HIF-1-alpha Transcription Factor Network Pathway||138045!!Integrated Pancreatic Cancer Pathway||711360!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Nuclear Receptor Transcription Pathway||105979
⇄specificity => string (23) "Recognizes human HNF4A."
$value[6]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[6]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[6]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[6]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[6]['_source']['app_tested']
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[6]['_source']['app_notes']
⇄⧉testing_protocols => string (1089) "WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell li...
$value[6]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA24534_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.||AAA24534_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml]||AAA24534_IF5.jpg!!WB (Western Blot)||Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.||AAA24534_WB4.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.||AAA24534_WB3.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2||AAA24534_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.74kD).||AAA24534_WB.jpg
⇄⧉etc_term1 => string (271) "Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (...
$value[6]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP!!Conjugate||APC
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) APC
⇄products_name_syn => string (3) "N/A"
$value[6]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HNF4A"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value[6]['_source']['products_description']
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[6]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉search_terms => string (1346) "aaa24534 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity c...
$value[6]['_source']['search_terms']
aaa24534 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes hnf4a elisa eia immunofluorescence if western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.74kd aaa24534_wb analysis of expression hepg2 aaa24534_wb2 jurkat aaa24534_wb3 transfected 293t cell line lane 1 lysate 51.6kd 2 non aaa24534_wb4 to hela concentration aaa24534_if5 testing data limit for recombinant gst tagged is ~1ng capture aaa24534_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24534_wb7 hepatocyte nuclear factor 4 alpha hnf transcription receptor subfamily group member 14 hnf4 nr2a1 tcf14 isoform hnf4alpha2 tcf mody frts4 mody1 hnf4a7 hnf4a8 hnf4a9 nr2a21 hnf4alpha hnf4alpha10 11 12 hepatic 43,988 da hnf4a_human 31077205 np_000448 p41235 nm_000457 a5jw41 o00659 o00723 q14540 q5qpb8 q6b4v5 q6b4v6 q6b4v7 q92653 q92654 b2rpp8 125850 antibodies factors partial corresponding aa324 423 from tag mw the alone 26kd sequence ndrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggspsdaphahhplhphlmqehmgtnvivantmpthlsngqmcewprp conjugate igg2a,k4e2 ph7.2 lane1 51.6kd2 expressed293 factor4 member14 hnf4alpha1011 aa324423
⇄specificity => string (23) "Recognizes human HNF4A."
$value[7]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[7]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[7]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[7]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[7]['_source']['app_tested']
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[7]['_source']['app_notes']
⇄⧉testing_protocols => string (1089) "WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell li...
$value[7]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA24829_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.||AAA24829_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml]||AAA24829_IF5.jpg!!WB (Western Blot)||Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.||AAA24829_WB4.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.||AAA24829_WB3.jpg!!WB (Western Blot)||HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2||AAA24829_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.74kD).||AAA24829_WB.jpg
⇄⧉etc_term1 => string (274) "Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (...
$value[7]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP!!Conjugate||Biotin
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (Biotin)
⇄products_name_syn => string (3) "N/A"
$value[7]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HNF4A"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value[7]['_source']['products_description']
⇄products_references => string (3) "N/A"
$value[7]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!L...
$value[7]['_source']['products_related_diseases']
Diabetes Mellitus, Type 2||183!!MATURITY-ONSET DIABETES OF THE YOUNG||134!!Liver Diseases||66!!Neoplasms||63!!Liver Neoplasms||41!!Carcinoma, Hepatocellular||40!!Hyperglycemia||33!!Fatty Liver||31!!Insulin Resistance||23!!Inflammation||17
⇄⧉search_terms => string (1333) "aaa24829 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity c...
$value[7]['_source']['search_terms']
aaa24829 mouse human monoclonal igg2a,k 4e2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes hnf4a elisa eia immunofluorescence if western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.74kd aaa24829_wb analysis of expression hepg2 aaa24829_wb2 jurkat aaa24829_wb3 transfected 293t cell line lane 1 lysate 51.6kd 2 non aaa24829_wb4 to hela concentration aaa24829_if5 testing data limit for recombinant gst tagged is ~1ng capture aaa24829_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24829_wb7 hepatocyte nuclear factor 4 alpha hnf transcription receptor subfamily group member 14 hnf4 nr2a1 tcf14 isoform hnf4alpha2 tcf mody frts4 mody1 hnf4a7 hnf4a8 hnf4a9 nr2a21 hnf4alpha hnf4alpha10 11 12 hepatic 43,988 da hnf4a_human 31077205 np_000448 p41235 nm_000457 a5jw41 o00659 o00723 q14540 q5qpb8 q6b4v5 q6b4v6 q6b4v7 q92653 q92654 b2rpp8 125850 antibodies factors partial corresponding aa324 423 from tag mw the alone 26kd sequence ndrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggspsdaphahhplhphlmqehmgtnvivantmpthlsngqmcewprp conjugate igg2a,k4e2 ph7.2 lane1 51.6kd2 expressed293 factor4 member14 hnf4alpha1011 aa324423
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[8]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[8]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[8]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[8]['_source']['app_notes']
⇄⧉testing_protocols => string (935) "IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 ...
$value[8]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]||AAA26513_IHC6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]||AAA26513_IHC5.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.||AAA26513_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26513_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26513_IF2.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody (M12), clone 6C12 Western Blot analysis of FOXA2 expression in K-562 (Cat # L009V1).||AAA26513_WB.jpg
⇄⧉etc_term1 => string (249) "Immunogen||FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with G...
$value[8]['_source']['etc_term1']
Immunogen||FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||HRP
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉products_description => string (830) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[9]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat PPAR-alpha monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (508) "aaa12430 rat typical testing data standard curve for reference only aaa12430...
$value[9]['_source']['search_terms']
aaa12430 rat typical testing data standard curve for reference only aaa12430_sc elisa kit peroxisome proliferator activated receptor alpha ppar a ppara nr1c1 hppar pparalpha nuclear subfamily 1 group c member proliferative variant 3 18,942 da ppara_human 765240 aab32649.1 q07869 q16241 q6i9s0 q92486 q92689 q9y3n1 b0g0x3 170998 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision subfamily1 variant3 range10
⇄specificity => string (23) "Recognizes human FOXA2."
$value[10]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[10]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[10]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[10]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[10]['_source']['app_notes']
⇄⧉testing_protocols => string (1187) "WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell li...
$value[10]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA25693_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is ~0.03ng/ml as a capture antibody.||AAA25693_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of FOXA2 transfected lysate using FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 rabbit polyclonal antibody.||AAA25693_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10ug/ml]||AAA25693_IF4.jpg!!WB (Western Blot)||Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody Lane 1: FOXA2 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.||AAA25693_WB3.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody Western Blot analysis of FOXA2 expression in HepG2.||AAA25693_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.19kD).||AAA25693_WB.jpg
⇄⧉etc_term1 => string (265) "Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (...
$value[10]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (NP_068556) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||PE
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉search_terms => string (1266) "aaa25693 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity c...
$value[10]['_source']['search_terms']
aaa25693 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes foxa2 elisa eia immunofluorescence if immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.19kd aaa25693_wb analysis of expression hepg2 aaa25693_wb2 transfected 293t cell line lane 1 lysate 48.3kd 2 non aaa25693_wb3 to concentration aaa25693_if4 using and magnetic bead immunoblotted rabbit polyclonal aaa25693_ip5 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25693_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity loading aaa25693_wb7 hepatocyte nuclear factor 3 beta hnf 3b forkhead box a2 transcription tcf hnf3b tcf3b mgc19807 isoform hepatic predicted 51 kda observed 54 foxa2_human 194394143 np_068556 q9y261 nm_021784 q8wuw4 q96df7 600288 antibodies factors partial corresponding aa363 457 from tag mw the alone 26kd sequence hlkpehhyafnhpfsinnlmsseqqhhhshhhhqphkmdlkayeqvmhypgygspmpgslamgpvtnktgldasplaadtsyyqgvysrpimnss conjugate igg2a,k7e6 ph7.2 lane1 48.3kd2 expressed293 factor3 predicted51 observed54 aa363457
⇄specificity => string (23) "Recognizes human FOXA2."
$value[11]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[11]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[11]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[11]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[11]['_source']['app_notes']
⇄⧉testing_protocols => string (1187) "WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell li...
$value[11]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA25104_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is ~0.03ng/ml as a capture antibody.||AAA25104_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of FOXA2 transfected lysate using FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 rabbit polyclonal antibody.||AAA25104_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10ug/ml]||AAA25104_IF4.jpg!!WB (Western Blot)||Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody Lane 1: FOXA2 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.||AAA25104_WB3.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody Western Blot analysis of FOXA2 expression in HepG2.||AAA25104_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.19kD).||AAA25104_WB.jpg
⇄⧉etc_term1 => string (267) "Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (...
$value[11]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (NP_068556) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||FITC
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉search_terms => string (1279) "aaa25104 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity c...
$value[11]['_source']['search_terms']
aaa25104 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes foxa2 elisa eia immunofluorescence if immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.19kd aaa25104_wb analysis of expression hepg2 aaa25104_wb2 transfected 293t cell line lane 1 lysate 48.3kd 2 non aaa25104_wb3 to concentration aaa25104_if4 using and magnetic bead immunoblotted rabbit polyclonal aaa25104_ip5 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25104_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity loading aaa25104_wb7 hepatocyte nuclear factor 3 beta hnf 3b forkhead box a2 transcription tcf hnf3b tcf3b mgc19807 isoform hepatic predicted 51 kda observed 54 foxa2_human 194394143 np_068556 q9y261 nm_021784 q8wuw4 q96df7 600288 antibodies factors partial corresponding aa363 457 from tag mw the alone 26kd sequence hlkpehhyafnhpfsinnlmsseqqhhhshhhhqphkmdlkayeqvmhypgygspmpgslamgpvtnktgldasplaadtsyyqgvysrpimnss conjugate igg2a,k7e6 ph7.2 lane1 48.3kd2 expressed293 factor3 predicted51 observed54 aa363457
⇄specificity => string (23) "Recognizes human FOXA2."
$value[12]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[12]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[12]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[12]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
$value[12]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[12]['_source']['app_notes']
⇄⧉testing_protocols => string (1187) "WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell li...
$value[12]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA24216_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is ~0.03ng/ml as a capture antibody.||AAA24216_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of FOXA2 transfected lysate using FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 rabbit polyclonal antibody.||AAA24216_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10ug/ml]||AAA24216_IF4.jpg!!WB (Western Blot)||Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody Lane 1: FOXA2 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.||AAA24216_WB3.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody Western Blot analysis of FOXA2 expression in HepG2.||AAA24216_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.19kD).||AAA24216_WB.jpg
⇄⧉etc_term1 => string (265) "Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (...
$value[12]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (NP_068556) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||AP
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉search_terms => string (1271) "aaa24216 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity c...
$value[12]['_source']['search_terms']
aaa24216 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes foxa2 elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 36.19kd aaa24216_wb analysis of expression hepg2 aaa24216_wb2 transfected 293t cell line lane 1 lysate 48.3kd 2 non aaa24216_wb3 immunofluorescence if to concentration 10ug ml aaa24216_if4 using and magnetic bead immunoblotted rabbit polyclonal aaa24216_ip5 testing data limit for recombinant gst tagged is ~0.03ng capture aaa24216_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity loading aaa24216_wb7 hepatocyte nuclear factor 3 beta hnf 3b forkhead box a2 transcription tcf hnf3b tcf3b mgc19807 isoform hepatic predicted 51 kda observed 54 foxa2_human 194394143 np_068556 q9y261 nm_021784 q8wuw4 q96df7 600288 antibodies factors partial corresponding aa363 457 from tag mw the alone 26kd sequence hlkpehhyafnhpfsinnlmsseqqhhhshhhhqphkmdlkayeqvmhypgygspmpgslamgpvtnktgldasplaadtsyyqgvysrpimnss conjugate igg2a,k7e6 ph7.2 lane1 48.3kd2 expressed293 factor3 predicted51 observed54 aa363457
⇄specificity => string (23) "Recognizes human FOXA2."
$value[13]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[13]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[13]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[13]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[13]['_source']['app_notes']
⇄⧉testing_protocols => string (1187) "WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell li...
$value[13]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA24807_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is ~0.03ng/ml as a capture antibody.||AAA24807_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of FOXA2 transfected lysate using FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 rabbit polyclonal antibody.||AAA24807_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10ug/ml]||AAA24807_IF4.jpg!!WB (Western Blot)||Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody Lane 1: FOXA2 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.||AAA24807_WB3.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody Western Blot analysis of FOXA2 expression in HepG2.||AAA24807_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.19kD).||AAA24807_WB.jpg
⇄⧉etc_term1 => string (269) "Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (...
$value[13]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (NP_068556) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||Biotin
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉search_terms => string (1254) "aaa24807 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity c...
$value[13]['_source']['search_terms']
aaa24807 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes foxa2 elisa eia immunofluorescence if immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.19kd aaa24807_wb analysis of expression hepg2 aaa24807_wb2 transfected 293t cell line lane 1 lysate 48.3kd 2 non aaa24807_wb3 to concentration aaa24807_if4 using and magnetic bead immunoblotted rabbit polyclonal aaa24807_ip5 testing data limit for recombinant gst tagged is ~0.03ng capture aaa24807_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity loading aaa24807_wb7 hepatocyte nuclear factor 3 beta hnf 3b forkhead box a2 transcription tcf hnf3b tcf3b mgc19807 isoform hepatic predicted 51 kda observed 54 foxa2_human 194394143 np_068556 q9y261 nm_021784 q8wuw4 q96df7 600288 antibodies factors partial corresponding aa363 457 from tag mw the alone 26kd sequence hlkpehhyafnhpfsinnlmsseqqhhhshhhhqphkmdlkayeqvmhypgygspmpgslamgpvtnktgldasplaadtsyyqgvysrpimnss conjugate igg2a,k7e6 ph7.2 lane1 48.3kd2 expressed293 factor3 predicted51 observed54 aa363457
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human NR4A2. No significant cross-reactivity or interference between human NR4A2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[14]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[14]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[14]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[14]['_source']['products_weight']
⇄products_status => boolean true
$value[14]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[14]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[14]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[14]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[14]['_source']['language_id']
⇄products_name => string (47) "nuclear receptor subfamily 4, group A, member 2"
$value[14]['_source']['products_name']
⇄products_name_oem => string (68) "Human Nuclear receptor subfamily 4 group A member 2, NR4A2 ELISA Kit"
$value[14]['_source']['products_name_oem']
⇄⧉products_name_syn => string (322) "Human Nuclear receptor subfamily 4 group A member 2 (NR4A2) ELISA kit; HZF-3...
$value[14]['_source']['products_name_syn']
Human Nuclear receptor subfamily 4 group A member 2 (NR4A2) ELISA kit; HZF-3; NOT; NURR1; RNR1; TINUR; NGFI-B/nur77 beta-type transcription factor homolog; OTTHUMP00000204707; T-cell nuclear receptor NOT; intermediate-early receptor protein; nur related protein-1; human ho; nuclear receptor subfamily 4; group A; member 2
⇄products_gene_name => string (5) "NR4A2"
$value[14]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[14]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[14]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for NR4A2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any NR4A2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for NR4A2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of NR4A2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[14]['_source']['products_references']
⇄⧉products_related_diseases => string (219) "Nervous System Diseases||106!!Brain Diseases||97!!Movement Disorders||69!!Ne...
⇄⧉search_terms => string (953) "aaa18108 human this assay has high sensitivity and excellent specificity for...
$value[14]['_source']['search_terms']
aaa18108 human this assay has high sensitivity and excellent specificity for detection of nr4a2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18108_td elisa kit nuclear receptor subfamily 4 group a member 2 hzf 3 not nurr1 rnr1 tinur ngfi b nur77 beta type transcription factor homolog otthump00000204707 t cell intermediate early protein nur related 1 ho orphan immediate response transcriptionally inducible 66,591 da nr4a2_human 5453822 np_006177.1 p43354 nm_006186.3 q16311 q53rz2 601828 samples serum plasma tissue homogenates lysates sandwich range 31.25 pg ml 2000 the minimum detectable dose is typically less than 7.81 ml.the lower limit lld defined as lowest concentration that could be differentiated from zero it determined mean o.d value 20 replicates added by their three deviations intra precision within an cv subfamily4 member2 hzf3 related1 value20
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[15]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[15]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
$value[15]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[15]['_source']['app_notes']
⇄⧉testing_protocols => string (920) "IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 ...
$value[15]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]||AAA25981_IHC6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]||AAA25981_IHC5.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.||AAA25981_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA25981_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA25981_IF2.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody (M12), clone 6C12 Western Blot analysis of FOXA2 expression in K-562.||AAA25981_WB.jpg
⇄⧉etc_term1 => string (248) "Immunogen||FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with G...
$value[15]['_source']['etc_term1']
Immunogen||FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||AP
⇄⧉products_description => string (554) "This gene encodes a member of the forkhead class of DNA-binding proteins. Th...
$value[15]['_source']['products_description']
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[16]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[16]['_source']['app_notes']
⇄⧉testing_protocols => string (935) "IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 ...
$value[16]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]||AAA26247_IHC6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]||AAA26247_IHC5.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.||AAA26247_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26247_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26247_IF2.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody (M12), clone 6C12 Western Blot analysis of FOXA2 expression in K-562 (Cat # L009V1).||AAA26247_WB.jpg
⇄⧉etc_term1 => string (252) "Immunogen||FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with G...
$value[16]['_source']['etc_term1']
Immunogen||FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||Biotin
⇄⧉products_description => string (554) "This gene encodes a member of the forkhead class of DNA-binding proteins. Th...
$value[16]['_source']['products_description']
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉products_description => string (824) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[17]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse T3 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[17]['_source']['products_references']
⇄⧉products_related_diseases => string (191) "Cardiovascular Diseases||19!!Thyroid Diseases||19!!Nervous System Diseases||...
⇄⧉search_terms => string (616) "aaa12607 mouse typical testing data standard curve for reference only aaa126...
$value[17]['_source']['search_terms']
aaa12607 mouse typical testing data standard curve for reference only aaa12607_sc elisa kit triiodothyronine t3 thyroid hormone receptor alpha isoform 2 thra ar7 ear7 erba chng6 erba1 nr1a1 thra1 thra2 erb t 1 c ear 7 related v protein nuclear subfamily group a member normone variant erythroblastic leukemia viral oncogene homolog avian 50,465 da tha_human 300116309 np_001177848.1 p10827 nm_001190919.1 p21205 q8n6a1 q96h73 a8k3b5 gene 614450 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision isoform2 t1 range10
⇄specificity => string (23) "Recognizes human FOXA2."
$value[18]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[18]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[18]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[18]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
$value[18]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[18]['_source']['app_notes']
⇄⧉testing_protocols => string (1187) "WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell li...
$value[18]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA25398_WB7.jpg!!Application Data||Detection limit for recombinant GST tagged FOXA2 is ~0.03ng/ml as a capture antibody.||AAA25398_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of FOXA2 transfected lysate using FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 rabbit polyclonal antibody.||AAA25398_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10ug/ml]||AAA25398_IF4.jpg!!WB (Western Blot)||Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody Lane 1: FOXA2 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.||AAA25398_WB3.jpg!!WB (Western Blot)||FOXA2 monoclonal antibody Western Blot analysis of FOXA2 expression in HepG2.||AAA25398_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.19kD).||AAA25398_WB.jpg
⇄⧉etc_term1 => string (266) "Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (...
$value[18]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa363-457 from human FOXA2 (NP_068556) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS!!Conjugate||HRP
⇄⧉products_description => string (361) "The transcription factor Foxa2 (also called hepatocyte nuclear factor 3beta,...
$value[18]['_source']['products_description']
The transcription factor Foxa2 (also called hepatocyte nuclear factor 3beta, [HNF-3beta) is implicated in blood glucose homeostasis. Overexpression of Foxa2 decrease heptocyte glycogen levels and reduce expression of glucoe homeostasis genes. The loss of Foxa2 function leads to up-regulation of hexokinase (HK) I and II and glucokinase (HK-IV) mRNA expression.
Cardiac Progenitor Differentiation Pathway||712094!!Developmental Biology Pathway||477129!!FOXA Transcription Factor Networks Pathway||138065!!FOXA1 Transcription Factor Network Pathway||137979!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Heart Development Pathway||198802!!Hedgehog Signaling Events Mediated By Gli Proteins Pathway||137912!!Maturity Onset Diabetes Of The Young Pathway||83096!!Maturity Onset Diabetes Of The Young Pathway||508!!Regulation Of Beta-cell Development Pathway||106328
⇄⧉search_terms => string (1274) "aaa25398 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity c...
$value[18]['_source']['search_terms']
aaa25398 mouse human monoclonal igg2a,k 7e6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes foxa2 elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 36.19kd aaa25398_wb analysis of expression hepg2 aaa25398_wb2 transfected 293t cell line lane 1 lysate 48.3kd 2 non aaa25398_wb3 immunofluorescence if to concentration 10ug ml aaa25398_if4 using and magnetic bead immunoblotted rabbit polyclonal aaa25398_ip5 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25398_td6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity loading aaa25398_wb7 hepatocyte nuclear factor 3 beta hnf 3b forkhead box a2 transcription tcf hnf3b tcf3b mgc19807 isoform hepatic predicted 51 kda observed 54 foxa2_human 194394143 np_068556 q9y261 nm_021784 q8wuw4 q96df7 600288 antibodies factors partial corresponding aa363 457 from tag mw the alone 26kd sequence hlkpehhyafnhpfsinnlmsseqqhhhshhhhqphkmdlkayeqvmhypgygspmpgslamgpvtnktgldasplaadtsyyqgvysrpimnss conjugate igg2a,k7e6 ph7.2 lane1 48.3kd2 expressed293 factor3 predicted51 observed54 aa363457
⇄⧉products_description => string (822) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[19]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat T3 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[19]['_source']['products_references']
⇄⧉products_related_diseases => string (191) "Cardiovascular Diseases||19!!Thyroid Diseases||19!!Nervous System Diseases||...
⇄⧉search_terms => string (614) "aaa12487 rat typical testing data standard curve for reference only aaa12487...
$value[19]['_source']['search_terms']
aaa12487 rat typical testing data standard curve for reference only aaa12487_sc elisa kit triiodothyronine t3 thyroid hormone receptor alpha isoform 2 thra ar7 ear7 erba chng6 erba1 nr1a1 thra1 thra2 erb t 1 c ear 7 related v protein nuclear subfamily group a member normone variant erythroblastic leukemia viral oncogene homolog avian 50,465 da tha_human 300116309 np_001177848.1 p10827 nm_001190919.1 p21205 q8n6a1 q96h73 a8k3b5 gene 614450 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision isoform2 t1 range10
