Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TOP2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Rabbit TOP2B Polyclonal Antibody | anti-TOP2B antibody

TOP2B antibody - middle region

Gene Names
TOP2B; TOPIIB; top2beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TOP2B; Polyclonal Antibody; TOP2B antibody - middle region; anti-TOP2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVA
Sequence Length
1621
Applicable Applications for anti-TOP2B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TOP2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TOP2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-TOP2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-TOP2B antibody
This is a rabbit polyclonal antibody against TOP2B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TOP2B is a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, beta, is localized to chromosome 3 and the alpha form is localized to chromosome 17. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. Alternative splicing of this gene results in two transcript variants; however, the second variant has not yet been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183kDa
NCBI Official Full Name
DNA topoisomerase 2-beta isoform 2
NCBI Official Synonym Full Names
DNA topoisomerase II beta
NCBI Official Symbol
TOP2B
NCBI Official Synonym Symbols
TOPIIB; top2beta
NCBI Protein Information
DNA topoisomerase 2-beta
UniProt Protein Name
DNA topoisomerase 2-beta
Protein Family
UniProt Gene Name
TOP2B
UniProt Entry Name
TOP2B_HUMAN

NCBI Description

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, beta, is localized to chromosome 3 and the alpha form is localized to chromosome 17. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]

Uniprot Description

TOP2B: Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks. Indirectly involved in vitamin D- coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR- mediated transrepression of the CYP27B1 gene. Belongs to the type II topoisomerase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Cell development/differentiation; Nucleolus; Topoisomerase; EC 5.99.1.3; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p24

Cellular Component: nucleoplasm; heterochromatin; DNA topoisomerase complex (ATP-hydrolyzing); cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: protein C-terminus binding; DNA topoisomerase (ATP-hydrolyzing) activity; enzyme binding; protein kinase C binding; protein heterodimerization activity; metal ion binding; histone deacetylase binding; chromatin binding; DNA bending activity; ATP binding

Biological Process: DNA unwinding during replication; mitotic recombination; DNA topological change; axonogenesis; forebrain development; sister chromatid segregation; neuron migration; resolution of meiotic joint molecules as recombinants

Research Articles on TOP2B

Similar Products

Product Notes

The TOP2B top2b (Catalog #AAA3201315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOP2B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOP2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOP2B top2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGNLFSFPSY SQKSEDDSAK FDSNEEDSAS VFSPSFGLKQ TDKVPSKTVA. It is sometimes possible for the material contained within the vial of "TOP2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.