Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit TNRC4 Polyclonal Antibody | anti-CELF3 antibody

TNRC4 antibody - N-terminal region

Gene Names
CELF3; CAGH4; ERDA4; ETR-1; TNRC4; BRUNOL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNRC4; Polyclonal Antibody; TNRC4 antibody - N-terminal region; anti-CELF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC
Sequence Length
465
Applicable Applications for anti-CELF3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TNRC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CELF3 antibody
This is a rabbit polyclonal antibody against TNRC4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
CUGBP Elav-like family member 3 isoform 1
NCBI Official Synonym Full Names
CUGBP Elav-like family member 3
NCBI Official Symbol
CELF3
NCBI Official Synonym Symbols
CAGH4; ERDA4; ETR-1; TNRC4; BRUNOL1
NCBI Protein Information
CUGBP Elav-like family member 3
UniProt Protein Name
CUGBP Elav-like family member 3
Protein Family
UniProt Gene Name
CELF3
UniProt Synonym Gene Names
BRUNOL1; CAGH4; ERDA4; TNRC4; CELF-3; ETR-1
UniProt Entry Name
CELF3_HUMAN

NCBI Description

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010]

Uniprot Description

TNRC4: RNA-binding protein involved in the regulation of pre- mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Activates the splicing of MAPT/Tau exon 10. Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Belongs to the CELF/BRUNOL family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytoplasm; nucleus

Molecular Function: mRNA binding; RNA binding; nucleotide binding

Biological Process: nuclear mRNA splicing, via spliceosome; positive regulation of nuclear mRNA splicing, via spliceosome; sperm motility; RNA splicing; spermatogenesis; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on CELF3

Similar Products

Product Notes

The CELF3 celf3 (Catalog #AAA3200475) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNRC4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TNRC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CELF3 celf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKEPDAIKLF VGQIPRHLEE KDLKPIFEQF GRIFELTVIK DKYTGLHKGC. It is sometimes possible for the material contained within the vial of "TNRC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.