Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNFSF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit anti-Human TNFSF4 Polyclonal Antibody | anti-TNFSF4 antibody

TNFSF4 antibody - middle region

Gene Names
TNFSF4; GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFSF4; Polyclonal Antibody; TNFSF4 antibody - middle region; anti-TNFSF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL
Sequence Length
183
Applicable Applications for anti-TNFSF4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TNFSF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNFSF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-TNFSF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-TNFSF4 antibody
This is a rabbit polyclonal antibody against TNFSF4. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 4 isoform 1
NCBI Official Synonym Full Names
TNF superfamily member 4
NCBI Official Symbol
TNFSF4
NCBI Official Synonym Symbols
GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B
NCBI Protein Information
tumor necrosis factor ligand superfamily member 4
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 4
UniProt Gene Name
TNFSF4
UniProt Synonym Gene Names
TXGP1; OX40L
UniProt Entry Name
TNFL4_HUMAN

NCBI Description

This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

TNFSF4: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T-cell-APC interaction and the functional consequences of T-cell activation, thereby destabilizing peripheral tolerance. Belongs to the tumor necrosis factor family.

Protein type: Cytokine; Cell cycle regulation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: extracellular space; cell surface; integral to plasma membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding; receptor binding

Biological Process: negative regulation of T-helper 1 cell differentiation; positive regulation of interleukin-12 production; negative regulation of cytokine secretion; positive regulation of T cell cytokine production; defense response to nematode; positive regulation of activated T cell proliferation; signal transduction; positive regulation of interleukin-10 production; positive regulation of interleukin-4 production; T cell proliferation; positive regulation of T-helper 2 cell differentiation; regulation of adaptive immune response; negative regulation of regulatory T cell differentiation; negative regulation of interferon-gamma production; positive regulation of cell proliferation; positive regulation of interleukin-13 production; positive regulation of memory T cell differentiation; cholesterol metabolic process; positive regulation of T-helper 2 type immune response; response to virus; negative regulation of transcription factor activity; positive regulation of immunoglobulin mediated immune response; positive regulation of interleukin-6 production; positive regulation of immunoglobulin secretion; positive regulation of CD4-positive, alpha beta T cell differentiation; positive regulation of interferon-gamma production; negative regulation of interleukin-17 production; positive regulation of B cell activation; regulation of inflammatory response; positive regulation of interleukin-2 production; positive regulation of alpha-beta T cell proliferation; immune response; negative regulation of transcription, DNA-dependent; acute inflammatory response; positive regulation of inflammatory response

Disease: Myocardial Infarction, Susceptibility To

Research Articles on TNFSF4

Similar Products

Product Notes

The TNFSF4 tnfsf4 (Catalog #AAA3214178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFSF4 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFSF4 tnfsf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEVNISLHYQ KDEEPLFQLK KVRSVNSLMV ASLTYKDKVY LNVTTDNTSL. It is sometimes possible for the material contained within the vial of "TNFSF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.