Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNFRSF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateTNFRSF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit anti-Human, Pig TNFRSF4 Polyclonal Antibody | anti-TNFRSF4 antibody

TNFRSF4 antibody - middle region

Gene Names
TNFRSF4; OX40; ACT35; CD134; IMD16; TXGP1L
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFRSF4; Polyclonal Antibody; TNFRSF4 antibody - middle region; anti-TNFRSF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ
Sequence Length
277
Applicable Applications for anti-TNFRSF4 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TNFRSF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNFRSF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateTNFRSF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-TNFRSF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateTNFRSF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-TNFRSF4 antibody
This is a rabbit polyclonal antibody against TNFRSF4. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 4
NCBI Official Synonym Full Names
TNF receptor superfamily member 4
NCBI Official Symbol
TNFRSF4
NCBI Official Synonym Symbols
OX40; ACT35; CD134; IMD16; TXGP1L
NCBI Protein Information
tumor necrosis factor receptor superfamily member 4
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 4
UniProt Gene Name
TNFRSF4
UniProt Synonym Gene Names
TXGP1L
UniProt Entry Name
TNR4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF4: Receptor for TNFSF4/OX40L/GP34.

Protein type: Apoptosis; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: cell surface; integral to plasma membrane; external side of plasma membrane

Molecular Function: tumor necrosis factor receptor activity

Biological Process: T cell proliferation; regulation of apoptosis; tumor necrosis factor-mediated signaling pathway; negative regulation of transcription factor activity; negative regulation of cytokine secretion; positive regulation of B cell proliferation; cellular defense response; immune response; positive regulation of immunoglobulin secretion; negative regulation of transcription, DNA-dependent; inflammatory response; regulation of protein kinase activity

Disease: Immunodeficiency 16

Research Articles on TNFRSF4

Similar Products

Product Notes

The TNFRSF4 tnfrsf4 (Catalog #AAA3214176) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF4 antibody - middle region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFRSF4 tnfrsf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKHTLQPASN SSDAICEDRD PPATQPQETQ GPPARPITVQ PTEAWPRTSQ. It is sometimes possible for the material contained within the vial of "TNFRSF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.