Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TNFAIP8L2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Rabbit anti-Mouse TNFAIP8L2 Polyclonal Antibody | anti-TNFAIP8L2 antibody

TNFAIP8L2 Polyclonal Antibody

Gene Names
TNFAIP8L2; TIPE2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TNFAIP8L2; Polyclonal Antibody; TNFAIP8L2 Polyclonal Antibody; TIPE2; anti-TNFAIP8L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Sequence Length
184
Applicable Applications for anti-TNFAIP8L2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human TNFAIP8L2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
Mouse thymus, Mouse spleen, Mouse small intestine
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TNFAIP8L2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TNFAIP8L2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Product Categories/Family for anti-TNFAIP8L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 20kDa
Observed: 20kDa
NCBI Official Full Name
tumor necrosis factor alpha-induced protein 8-like protein 2
NCBI Official Synonym Full Names
TNF alpha induced protein 8 like 2
NCBI Official Symbol
TNFAIP8L2
NCBI Official Synonym Symbols
TIPE2
NCBI Protein Information
tumor necrosis factor alpha-induced protein 8-like protein 2
UniProt Protein Name
Tumor necrosis factor alpha-induced protein 8-like protein 2
UniProt Gene Name
TNFAIP8L2
UniProt Synonym Gene Names
TIPE2; TNF alpha-induced protein 8-like protein 2; TNFAIP8-like protein 2

Uniprot Description

Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis ().

Research Articles on TNFAIP8L2

Similar Products

Product Notes

The TNFAIP8L2 tnfaip8l2 (Catalog #AAA9133726) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFAIP8L2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TNFAIP8L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the TNFAIP8L2 tnfaip8l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESFSSKSLA LQAEKKLLSK MAGRSVAHLF IDETSSEVLD ELYRVSKEYT HSRPQAQRVI KDLIKVAIKV AVLHRNGSFG PSELALATRF RQKLRQGAMT ALSFGEVDFT FEAAVLAGLL TECRDVLLEL VEHHLTPKSH GRIRHVFDHF SDPGLLTALY GPDFTQHLGK ICDGLRKLLD EGKL. It is sometimes possible for the material contained within the vial of "TNFAIP8L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.