Western Blot (WB)
(Host: RabbitTarget Name: TNFAIP2Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Rabbit TNFAIP2 Polyclonal Antibody | anti-TNFAIP2 antibody
TNFAIP2 Antibody - N-terminal region
Gene Names
TNFAIP2; B94; EXOC3L3
Reactivity
Dog, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFAIP2; Polyclonal Antibody; TNFAIP2 Antibody - N-terminal region; anti-TNFAIP2 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG
Sequence Length
654
Applicable Applications for anti-TNFAIP2 antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 100%; Human: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNFAIP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TNFAIP2Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TNFAIP2Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-TNFAIP2 antibody
This is a rabbit polyclonal antibody against TNFAIP2. It was validated on Western Blot
Target Description: This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia.
Target Description: This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia.
Product Categories/Family for anti-TNFAIP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
tumor necrosis factor alpha-induced protein 2
NCBI Official Synonym Full Names
TNF alpha induced protein 2
NCBI Official Symbol
TNFAIP2
NCBI Official Synonym Symbols
B94; EXOC3L3
NCBI Protein Information
tumor necrosis factor alpha-induced protein 2
UniProt Protein Name
Tumor necrosis factor alpha-induced protein 2
Protein Family
UniProt Gene Name
TNFAIP2
UniProt Synonym Gene Names
TNF alpha-induced protein 2
UniProt Entry Name
TNAP2_HUMAN
NCBI Description
This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia. [provided by RefSeq, Jul 2008]
Uniprot Description
TNFAIP2: May play a role as a mediator of inflammation and angiogenesis. Belongs to the SEC6 family.
Chromosomal Location of Human Ortholog: 14q32
Cellular Component: extracellular space; exocyst
Molecular Function: SNARE binding
Biological Process: exocytosis; angiogenesis; exocyst localization; cell differentiation
Research Articles on TNFAIP2
Similar Products
Product Notes
The TNFAIP2 tnfaip2 (Catalog #AAA3219231) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFAIP2 Antibody - N-terminal region reacts with Dog, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TNFAIP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFAIP2 tnfaip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAAKKKKEKK KKSKGLANVF CVFTKGKKKK GQPSSAEPED AAGSRQGLDG. It is sometimes possible for the material contained within the vial of "TNFAIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
