Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TMX1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit TMX1 Polyclonal Antibody | anti-TMX1 antibody

TMX1 antibody - C-terminal region

Gene Names
TMX1; TMX; TXNDC; PDIA11; TXNDC1
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMX1; Polyclonal Antibody; TMX1 antibody - C-terminal region; anti-TMX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQ
Sequence Length
280
Applicable Applications for anti-TMX1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 82%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TMX1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-TMX1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-TMX1 antibody
This is a rabbit polyclonal antibody against TMX1. It was validated on Western Blot

Target Description: TXNDC1 is a thioredoxin (TXN; see MIM 187700)-related protein with disulfide reductase activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
thioredoxin-related transmembrane protein 1
NCBI Official Synonym Full Names
thioredoxin related transmembrane protein 1
NCBI Official Symbol
TMX1
NCBI Official Synonym Symbols
TMX; TXNDC; PDIA11; TXNDC1
NCBI Protein Information
thioredoxin-related transmembrane protein 1
UniProt Protein Name
Thioredoxin-related transmembrane protein 1
UniProt Gene Name
TMX1
UniProt Synonym Gene Names
TMX; TXNDC; TXNDC1
UniProt Entry Name
TMX1_HUMAN

NCBI Description

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides. [provided by RefSeq, Jan 2017]

Uniprot Description

TXNDC1: May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q22.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; nucleolus; integral to membrane

Molecular Function: disulfide oxidoreductase activity; protein disulfide isomerase activity

Biological Process: protein folding; cell redox homeostasis

Research Articles on TMX1

Similar Products

Product Notes

The TMX1 tmx1 (Catalog #AAA3215808) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMX1 antibody - C-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TMX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMX1 tmx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPSKKLLSES AQPLKKVEEE QEADEEDVSE EEAESKEGTN KDFPQNAIRQ. It is sometimes possible for the material contained within the vial of "TMX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.