Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMPOSample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TMPO Polyclonal Antibody | anti-TMPO antibody

TMPO Antibody - middle region

Gene Names
TMPO; TP; LAP2; CMD1T; LEMD4; PRO0868
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMPO; Polyclonal Antibody; TMPO Antibody - middle region; anti-TMPO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEGKKKEHKKVKSTR
Sequence Length
694
Applicable Applications for anti-TMPO antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMPO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMPOSample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMPOSample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TMPO antibody
The protein encoded by this gene resides in the nucleus and may play a role in the assembly of the nuclear lamina, and thus help maintain the structural organization of the nuclear envelope. It may function as a receptor for the attachment of lamin filaments to the inner nuclear membrane. Mutations in this gene are associated with dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76 kDa
NCBI Official Full Name
thymopoietin isoform alpha
NCBI Official Synonym Full Names
thymopoietin
NCBI Official Symbol
TMPO
NCBI Official Synonym Symbols
TP; LAP2; CMD1T; LEMD4; PRO0868
NCBI Protein Information
thymopoietin
UniProt Protein Name
Lamina-associated polypeptide 2, isoform alpha
UniProt Gene Name
TMPO
UniProt Synonym Gene Names
LAP2; TP alpha; TPRP isoform alpha; TP
UniProt Entry Name
LAP2A_HUMAN

NCBI Description

The protein encoded by this gene resides in the nucleus and may play a role in the assembly of the nuclear lamina, and thus help maintain the structural organization of the nuclear envelope. It may function as a receptor for the attachment of lamin filaments to the inner nuclear membrane. Mutations in this gene are associated with dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, May 2010]

Uniprot Description

TMPO iso6: a single-pass type II membrane protein. Tightly associated with the nuclear lamina. Binds DNA and involved in DNA replication and chromatin remodeling, May help direct the assembly of the nuclear lamina and thereby help maintain the structural organization of the nuclear envelope. Possible receptor for attachment of lamin filaments to the inner nuclear membrane. May be involved in the control of initiation of DNA replication through its interaction with HAP95. Associated with dilated cardiomyopathy; upregulated in medulloblastoma. Used as a pharmaceutical to treat primary and secondary immune deficiencies, autoimmunity, infections and cancer. Available under the names Timunox (Cilag), Sintomodulina (Italofarmaco) and Mepentil (Recordati). Three alternatively spliced isoforms have been described.

Protein type: DNA-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q22

Cellular Component: nuclear membrane; membrane; cytoplasm; integral to membrane; nuclear inner membrane; nuclear envelope; chromatin; nucleus

Molecular Function: protein binding; DNA binding; lamin binding

Biological Process: regulation of transcription, DNA-dependent

Disease: Cardiomyopathy, Dilated, 1t

Research Articles on TMPO

Similar Products

Product Notes

The TMPO tmpo (Catalog #AAA3219854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPO Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMPO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMPO tmpo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGTESRSSTP LPTISSSAEN TRQNGSNDSD RYSDNEEGKK KEHKKVKSTR. It is sometimes possible for the material contained within the vial of "TMPO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.