Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PDE4C is 0.1 ng/ml as a capture antibody.)

Mouse PDE4C Monoclonal Antibody | anti-PDE4C antibody

PDE4C (Phosphodiesterase 4C, cAMP-Specific (Phosphodiesterase E1 dunce Homolog, Drosophila), DPDE1, MGC126222) (Biotin)

Gene Names
PDE4C; DPDE1
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PDE4C; Monoclonal Antibody; PDE4C (Phosphodiesterase 4C; cAMP-Specific (Phosphodiesterase E1 dunce Homolog; Drosophila); DPDE1; MGC126222) (Biotin); Phosphodiesterase 4C; MGC126222; anti-PDE4C antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
400000
Specificity
Recognizes PDE4C.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PDE4C antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PDE4C (NP_000914, 1aa-99aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS
Conjugate
Biotin
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PDE4C is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDE4C is 0.1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PDE4C on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PDE4C on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PDE4C on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PDE4C on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-PDE4C antibody
Mouse monoclonal antibody raised against a partial recombinant PDE4C.
Product Categories/Family for anti-PDE4C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4C isoform PDE4C1
NCBI Official Synonym Full Names
phosphodiesterase 4C, cAMP-specific
NCBI Official Symbol
PDE4C
NCBI Official Synonym Symbols
DPDE1
NCBI Protein Information
cAMP-specific 3',5'-cyclic phosphodiesterase 4C; PDE21; phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
UniProt Protein Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
UniProt Gene Name
PDE4C
UniProt Synonym Gene Names
DPDE1
UniProt Entry Name
PDE4C_HUMAN

Uniprot Description

PDE4C: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphodiesterase; Nucleotide Metabolism - purine; EC 3.1.4.53

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: extracellular space; cytosol

Molecular Function: 3',5'-cyclic-AMP phosphodiesterase activity; metal ion binding

Biological Process: cAMP catabolic process; signal transduction

Similar Products

Product Notes

The PDE4C pde4c (Catalog #AAA6173640) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PDE4C can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDE4C pde4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDE4C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.