Western Blot (WB)
(TMEM24 antibody (MBS5301072) used at 0.5 ug/ml to detect target protein.)
Rabbit TMEM24 Polyclonal Antibody | anti-TMEM24 antibody
TMEM24 antibody
Gene Names
C2CD2L; DLNB23; TMEM24
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM24; Polyclonal Antibody; TMEM24 antibody; Polyclonal TMEM24; Anti-TMEM24; TMEM-24; DLNB23; KIAA0285; C2CD2L; TMEM 24; Transmembrane Protein 24; anti-TMEM24 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
TMEM24 antibody was raised against the C terminal Of Tmem24
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM24 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
612
Applicable Applications for anti-TMEM24 antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TMEM24 antibody (MBS5301072) used at 0.5 ug/ml to detect target protein.)
Western Blot (WB)
(TMEM24 antibody (MBS5301072) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-TMEM24 antibody
Rabbit polyclonal TMEM24 antibody raised against the C terminal Of Tmem24
Product Categories/Family for anti-TMEM24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
76 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 24, isoform CRA_d
NCBI Official Synonym Full Names
C2CD2-like
NCBI Official Symbol
C2CD2L
NCBI Official Synonym Symbols
DLNB23; TMEM24
NCBI Protein Information
C2 domain-containing protein 2-like
UniProt Protein Name
C2 domain-containing protein 2-like
UniProt Gene Name
C2CD2L
UniProt Synonym Gene Names
KIAA0285; TMEM24
UniProt Entry Name
C2C2L_HUMAN
Uniprot Description
TMEM24: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 11q23.3
Cellular Component: integral to membrane
Molecular Function: insulin binding
Research Articles on TMEM24
Similar Products
Product Notes
The TMEM24 c2cd2l (Catalog #AAA5301072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM24 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the TMEM24 c2cd2l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
