Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMEM16C antibody (MBS5302897) used at 1 ug/ml to detect target protein.)

Rabbit TMEM16C Polyclonal Antibody | anti-TMEM16C antibody

TMEM16C antibody

Gene Names
ANO3; DYT23; DYT24; TMEM16C; C11orf25; GENX-3947
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM16C; Polyclonal Antibody; TMEM16C antibody; Polyclonal TMEM16C; Anti-TMEM16C; GENX-3947; C11orf25; TMEMC-16; TMEMC 16; Transmembrane Protein 16C; anti-TMEM16C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
TMEM16C antibody was raised against the C terminal of TMEM16C
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM16C antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
981
Applicable Applications for anti-TMEM16C antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
TMEM16C antibody was raised using the C terminal of TMEM16C corresponding to a region with amino acids  AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(TMEM16C antibody (MBS5302897) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (TMEM16C antibody (MBS5302897) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM16C antibody
Rabbit polyclonal TMEM16C antibody raised against the C terminal of TMEM16C
Product Categories/Family for anti-TMEM16C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
115 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 16C
NCBI Official Synonym Full Names
anoctamin 3
NCBI Official Symbol
ANO3
NCBI Official Synonym Symbols
DYT23; DYT24; TMEM16C; C11orf25; GENX-3947
NCBI Protein Information
anoctamin-3
UniProt Protein Name
Anoctamin-3
UniProt Gene Name
ANO3
UniProt Synonym Gene Names
C11orf25; TMEM16C
UniProt Entry Name
ANO3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the TMEM16 family of predicted membrane proteins, that are also known as anoctamins. While little is known about the function of this gene, mutations in this gene have been associated with some cases of autosomal dominant craniocervical dystonia. Cells from individuals with a mutation in this gene exhibited abnormalities in endoplasmic reticulum-dependent calcium signaling. Studies in rat show that the rat ortholog of this protein interacts with, and modulates the activity of a sodium-activated potassium channel. Deletion of this gene caused increased pain sensitivity in the rat model system. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]

Uniprot Description

ANO3: May act as a calcium-activated chloride channel. Belongs to the anoctamin family.

Protein type: Transporter; Transporter, ion channel; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p14.2

Cellular Component: integral to membrane; plasma membrane

Molecular Function: phospholipid scramblase activity; intracellular calcium activated chloride channel activity

Biological Process: lipid transport; transmembrane transport

Disease: Dystonia 24

Research Articles on TMEM16C

Similar Products

Product Notes

The TMEM16C ano3 (Catalog #AAA5302897) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM16C antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM16C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM16C ano3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM16C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.