Western Blot (WB)
(Figure 1. Western blot analysis of TMEM16A using anti-TMEM16A antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate,Lane 2: human HepG2 whole cell lysate,Lane 3: human A549 whole cell lysate,Lane 4: human PANC-1 whole cell lysate,Lane 5: human SK-OV-3 whole cell lysate,Lane 6: human SGC-7901 whole cell lysate,Lane 7: human COLO-320 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM16A antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TMEM16A at approximately 130KD. The expected band size for TMEM16A is at 114KD.)
Rabbit TMEM16A/ANO1 Polyclonal Antibody | anti-TMEM16A antibody
Anti-TMEM16A/ANO1 Antibody
Gene Names
ANO1; DOG1; TAOS2; ORAOV2; TMEM16A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TMEM16A/ANO1; Polyclonal Antibody; Anti-TMEM16A/ANO1 Antibody; Anoctamin-1; Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2; ANO1; DOG1; ORAOV2; TAOS2; TMEM16A; Anoctamin 1; calcium activated chloride channel; anti-TMEM16A antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
840
Applicable Applications for anti-TMEM16A antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5 mug/ml
Tested Species: In-house tested species with positive results.
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human TMEM16A (QQIHKEK VLMVELFMREEQDKQQLLETWMEKERQKDE).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Western Blot (WB)
(Figure 1. Western blot analysis of TMEM16A using anti-TMEM16A antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate,Lane 2: human HepG2 whole cell lysate,Lane 3: human A549 whole cell lysate,Lane 4: human PANC-1 whole cell lysate,Lane 5: human SK-OV-3 whole cell lysate,Lane 6: human SGC-7901 whole cell lysate,Lane 7: human COLO-320 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM16A antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TMEM16A at approximately 130KD. The expected band size for TMEM16A is at 114KD.)
Western Blot (WB)
(Figure 1. Western blot analysis of TMEM16A using anti-TMEM16A antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate,Lane 2: human HepG2 whole cell lysate,Lane 3: human A549 whole cell lysate,Lane 4: human PANC-1 whole cell lysate,Lane 5: human SK-OV-3 whole cell lysate,Lane 6: human SGC-7901 whole cell lysate,Lane 7: human COLO-320 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM16A antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TMEM16A at approximately 130KD. The expected band size for TMEM16A is at 114KD.)
Related Product Information for anti-TMEM16A antibody
Description: Rabbit IgG polyclonal antibody for TMEM16A detection. Tested with WB in Human; Mouse; Rat.
Background: Anoctamin-1 (ANO1), also known as oral cancer overexpressed 2 (ORAOV2) or tumor-amplified and overexpressed sequence 2 (TMEM16A), is a protein that in humans is encoded by the ANO1 gene. This gene belongs to a family of membrane proteins containing 8 transmembrane segments, and it is mapped to 11q13.3. ANO1 is a candidate calcium-activated chloride channel that mediates receptor-activated chloride currents in diverse physiologic processes, and it is thought to be responsible for a voltage-sensitive calcium-activated chloride current. Its overexpression was reported in esophageal squamous cell carcinoma and breast cancer progression Crofelemer, an antidiarrhoeal, inhibits this channel. ANO1 has eight transmembrane domains, its pore is large and non-selective, allowing other negatively charged species to permeate.
Background: Anoctamin-1 (ANO1), also known as oral cancer overexpressed 2 (ORAOV2) or tumor-amplified and overexpressed sequence 2 (TMEM16A), is a protein that in humans is encoded by the ANO1 gene. This gene belongs to a family of membrane proteins containing 8 transmembrane segments, and it is mapped to 11q13.3. ANO1 is a candidate calcium-activated chloride channel that mediates receptor-activated chloride currents in diverse physiologic processes, and it is thought to be responsible for a voltage-sensitive calcium-activated chloride current. Its overexpression was reported in esophageal squamous cell carcinoma and breast cancer progression Crofelemer, an antidiarrhoeal, inhibits this channel. ANO1 has eight transmembrane domains, its pore is large and non-selective, allowing other negatively charged species to permeate.
References
1. Caputo A, Caci E, Ferrera L, Pedemonte N, Barsanti C, Sondo E, Pfeffer U, Ravazzolo R, Zegarra-Moran O, Galietta LJ (October 2008). "TMEM16A, a membrane protein associated with calcium-dependent chloride channel activity". Science 322 (5901): 590-4.Hai, T., Liu, F., Coukos, W. J., Green, M. R.Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.Genes Dev. 3: 2083-2090, 1989. 2. Katoh M, Katoh M (June 2003). "FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products". Int. J. Oncol. 22 (6): 1375-81. 3. Yang, Y. D., Cho, H., Koo, J. Y., Tak, M. H., Cho, Y., Shim, W.-S., Park, S. P., Lee, J., Lee, B., Kim, B.-M., Raouf, R., Shin, Y. K., Oh, U. TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature 455: 1210-1215, 2008.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
97,736 Da
NCBI Official Full Name
anoctamin-1
NCBI Official Synonym Full Names
anoctamin 1
NCBI Official Symbol
ANO1
NCBI Official Synonym Symbols
DOG1; TAOS2; ORAOV2; TMEM16A
NCBI Protein Information
anoctamin-1
UniProt Protein Name
Anoctamin-1
UniProt Gene Name
ANO1
UniProt Synonym Gene Names
DOG1; ORAOV2; TAOS2; TMEM16A
Uniprot Description
Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Research Articles on TMEM16A
Similar Products
Product Notes
The TMEM16A ano1 (Catalog #AAA1751268) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-TMEM16A/ANO1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM16A/ANO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5 mug/ml Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the TMEM16A ano1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM16A/ANO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
