Western Blot (WB)
(TMEM146 antibody (MBS5303269) used at 1 ug/ml to detect target protein.)
Rabbit TMEM146 Polyclonal Antibody | anti-TMEM146 antibody
TMEM146 antibody
Gene Names
CATSPERD; TMEM146
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM146; Polyclonal Antibody; TMEM146 antibody; Polyclonal TMEM146; Anti-TMEM146; TMEM 146; MGC39581; TMEM-146; Transmembrane Protein 146; anti-TMEM146 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
TMEM146 antibody was raised against the middle region of TMEM146
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM146 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
468
Applicable Applications for anti-TMEM146 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.
Cross-Reactivity
Human
Immunogen
TMEM146 antibody was raised using the middle region of TMEM146 corresponding to a region with amino acids NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TMEM146 antibody (MBS5303269) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TMEM146 antibody (MBS5303269) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM146 antibody
Rabbit polyclonal TMEM146 antibody raised against the middle region of TMEM146
Product Categories/Family for anti-TMEM146 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
90 kDa (MW of target protein)
NCBI Official Full Name
TMEM146 protein, partial
NCBI Official Synonym Full Names
catsper channel auxiliary subunit delta
NCBI Official Symbol
CATSPERD
NCBI Official Synonym Symbols
TMEM146
NCBI Protein Information
cation channel sperm-associated protein subunit delta
UniProt Protein Name
Cation channel sperm-associated protein subunit delta
UniProt Gene Name
CATSPERD
UniProt Synonym Gene Names
TMEM146; CatSper-delta; CatSperdelta
UniProt Entry Name
CTSRD_HUMAN
Uniprot Description
TMEM146: Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization. Required for CATSPER1 stability before intraflagellar transport and/or incorporation of the CatSper complex channel into the flagellar membrane. Belongs to the CATSPERD family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 19p13.3
Cellular Component: plasma membrane
Biological Process: sperm-egg recognition; sperm motility; multicellular organismal development; single fertilization; spermatogenesis; sperm capacitation; multicellular organism reproduction
Research Articles on TMEM146
Similar Products
Product Notes
The TMEM146 catsperd (Catalog #AAA5303269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMEM146 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM146 catsperd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM146, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
