Western Blot (WB)
(WB Suggested Anti-TM4SF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)
Rabbit TM4SF20 Polyclonal Antibody | anti-TM4SF20 antibody
TM4SF20 antibody - middle region
Gene Names
TM4SF20; SLI5; PRO994; TCCE518
Reactivity
Dog, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TM4SF20; Polyclonal Antibody; TM4SF20 antibody - middle region; anti-TM4SF20 antibody
Host
Rabbit
Reactivity
Dog, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG
Sequence Length
229
Applicable Applications for anti-TM4SF20 antibody
Western Blot (WB)
Homology
Dog: 77%; Human: 100%; Rabbit: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TM4SF20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TM4SF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TM4SF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)
Related Product Information for anti-TM4SF20 antibody
This is a rabbit polyclonal antibody against TM4SF20. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-TM4SF20 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
transmembrane 4 L6 family member 20
NCBI Official Synonym Full Names
transmembrane 4 L six family member 20
NCBI Official Symbol
TM4SF20
NCBI Official Synonym Symbols
SLI5; PRO994; TCCE518
NCBI Protein Information
transmembrane 4 L6 family member 20
UniProt Protein Name
Transmembrane 4 L6 family member 20
Protein Family
UniProt Gene Name
TM4SF20
UniProt Synonym Gene Names
UNQ518/PRO994
UniProt Entry Name
T4S20_HUMAN
NCBI Description
The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Knockout of the homologous gene in mouse results in a neurobehavioral phenotype with suggested enhanced motor coordination. A deletion mutation in the human gene is associated with specific language impairment-5. [provided by RefSeq, Jul 2016]
Research Articles on TM4SF20
Similar Products
Product Notes
The TM4SF20 tm4sf20 (Catalog #AAA3209680) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TM4SF20 antibody - middle region reacts with Dog, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TM4SF20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TM4SF20 tm4sf20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QALLKGPLMC NSPSNSNANC EFSLKNISDI HPESFNLQWF FNDSCAPPTG. It is sometimes possible for the material contained within the vial of "TM4SF20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
