Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Goat anti-Human TLR5 Polyclonal Antibody

TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Flow Cytometry, Functional Assay
Purity
Affinity Purified
Purified by epitope affinity chromatography.
Synonyms
TLR5; Polyclonal Antibody; TLR5 (Toll Like Receptor 5; Toll-like Receptor 5 Precursor; TLR 5; TLR-5; FLJ10052; MGC126430; MGC126431; Toll/interleukin 1 Receptor-like Protein 3; TIL3); Anti -TLR5 (Toll Like Receptor 5; anti-TLR5 antibody
Ordering
For Research Use Only!
Host
Goat
Reactivity
Human
Clonality
Polyclonal
Specificity
Recognizes human TLR5.
Purity/Purification
Affinity Purified
Purified by epitope affinity chromatography.
Form/Format
Supplied as a liquid in PBS containing 1mg/ml BSA and 0.1% sodium azide.
Applicable Applications for anti-TLR5 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Flow Cytometry (FC/FACS)
Application Notes
Suitable for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry and Western Blot.
Dilution: Immunocytochemistry: 1:500. Used on peripheral blood leukocytes.
Immunohistochemistry (paraffin sections): 1:250.
Immunogen
Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
Preparation and Storage
May be stored at 4 degree C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Product Categories/Family for anti-TLR5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
TLR5
Protein Family

Similar Products

Product Notes

The TLR5 (Catalog #AAA615491) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. The TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TLR5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Flow Cytometry (FC/FACS). Suitable for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry and Western Blot. Dilution: Immunocytochemistry: 1:500. Used on peripheral blood leukocytes. Immunohistochemistry (paraffin sections): 1:250. Researchers should empirically determine the suitability of the TLR5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLR5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.