Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TJP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateTJP2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit TJP2 Polyclonal Antibody | anti-TJP2 antibody

TJP2 antibody - middle region

Gene Names
TJP2; ZO2; X104; PFIC4; DFNA51; DUP9q21.11; C9DUPq21.11
Reactivity
Dog, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TJP2; Polyclonal Antibody; TJP2 antibody - middle region; anti-TJP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK
Sequence Length
1190
Applicable Applications for anti-TJP2 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 92%; Human: 100%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TJP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TJP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateTJP2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-TJP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateTJP2 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-TJP2 antibody
This is a rabbit polyclonal antibody against TJP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1975 BC027592.1 10-1984 1976-2543 L27476.1 1855-2422 2544-3080 BC028426.1 2440-2976 3081-4167 BC027592.1 3090-4176 4168-4601 L27476.1 4051-4484 4602-4618 BC028426.1 4056-4072
Product Categories/Family for anti-TJP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134kDa
NCBI Official Full Name
tight junction protein ZO-2 isoform 1
NCBI Official Synonym Full Names
tight junction protein 2
NCBI Official Symbol
TJP2
NCBI Official Synonym Symbols
ZO2; X104; PFIC4; DFNA51; DUP9q21.11; C9DUPq21.11
NCBI Protein Information
tight junction protein ZO-2
UniProt Protein Name
Tight junction protein ZO-2
Protein Family
UniProt Gene Name
TJP2
UniProt Synonym Gene Names
X104; ZO2
UniProt Entry Name
ZO2_HUMAN

NCBI Description

This gene encodes a zonula occluden that is a member of the membrane-associated guanylate kinase homolog family. The encoded protein functions as a component of the tight junction barrier in epithelial and endothelial cells and is necessary for proper assembly of tight junctions. Mutations in this gene have been identified in patients with hypercholanemia, and genomic duplication of a 270 kb region including this gene causes autosomal dominant deafness-51. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

ZO2: a scaffolding protein of the MAGUK (membrane-associated guanylate kinase) family associated with epithelial tight junctions (TJ). May mediate dynamic changes in the composition of TJs. Plays a role in tight junctions and adherens junctions. Forms homodimers, and heterodimer with ZO-1 and ZO-3. The ZOs shuttle between the TJ and the nucleus, where they may regulate gene expression. Interacts with occluding, UBN1 and scribble. Interacts with SAFB in the nucleus. TJ, or zonula occludens, are the closely associated areas of two cells whose membranes are tightly joined together. They are composed of a branching network of strands, the efficiency of which increases exponentially with the number of strands. The strands associate with transmembrane proteins that bind to similar proteins on adjacent cells, and with submembranous proteins that are anchored to the actin component of the cytoskeleton. Thus, TJs join together the cytoskeletons of adjacent cells. They endow tissues with substantial form, shape and location, enforce cellular polarity, and form barriers to molecules and pathogens. Molecules forming the membranous part of TJs include occludin, claudins, tricellulin and junctional adhesion molecules. These molecules interact with the proteins ZO-1, ZO-2 and ZO-3. Tight junction proteins are involved in the epithelial-mesenchymal transitions (EMT) in tumors. Five isoforms of the human protein are produced by alternative promoters. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues..

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9q13-q21

Cellular Component: nucleoplasm; tight junction; adherens junction; cytoplasm; plasma membrane; cell junction; cytosol

Molecular Function: protein binding, bridging; protein C-terminus binding; protein domain specific binding; guanylate kinase activity; protein binding

Biological Process: response to organic substance; apoptosis; cell structure disassembly during apoptosis; nucleotide phosphorylation; intestinal absorption

Disease: Hypercholanemia, Familial; Cholestasis, Progressive Familial Intrahepatic, 4

Research Articles on TJP2

Similar Products

Product Notes

The TJP2 tjp2 (Catalog #AAA3206625) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TJP2 antibody - middle region reacts with Dog, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TJP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TJP2 tjp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVVPETNKEP RYQEDPPAPQ PKAAPRTFLR PSPEDEAIYG PNTKMVRFKK. It is sometimes possible for the material contained within the vial of "TJP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.