Western Blot (WB)
(Western blot-TIMMDC1 Polyclonal Antibody)
Rabbit anti-Human TIMMDC1 Polyclonal Antibody | anti-TIMMDC1 antibody
TIMMDC1 Polyclonal Antibody
Gene Names
TIMMDC1; C3orf1; MC1DN31
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TIMMDC1; Polyclonal Antibody; TIMMDC1 Polyclonal Antibody; C3orf1; complex I assembly factor TIMMDC1; mitochondrial; anti-TIMMDC1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.05 mg/ml (varies by lot)
Sequence Length
285
Applicable Applications for anti-TIMMDC1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 206-285 of human TIMMDC1 (NP_057673.2).
Immunogen Sequence
LMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Positive Samples
THP-1, U-937, A-375
Cellular Location
Mitochondrion Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-TIMMDC1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-TIMMDC1 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 32kDa
Observed: 32kDa
Observed: 32kDa
NCBI Official Full Name
complex I assembly factor TIMMDC1, mitochondrial
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane domain containing 1
NCBI Official Symbol
TIMMDC1
NCBI Official Synonym Symbols
C3orf1; MC1DN31
NCBI Protein Information
complex I assembly factor TIMMDC1, mitochondrial
UniProt Protein Name
Complex I assembly factor TIMMDC1, mitochondrial
Protein Family
UniProt Gene Name
TIMMDC1
UniProt Synonym Gene Names
C3orf1; UNQ247/PRO284; TIMM domain containing-protein 1
UniProt Entry Name
TIDC1_HUMAN
Research Articles on TIMMDC1
Similar Products
Product Notes
The TIMMDC1 timmdc1 (Catalog #AAA9140547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIMMDC1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIMMDC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TIMMDC1 timmdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMMDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
